DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neu2 and ZNF7

DIOPT Version :9

Sequence 1:NP_649316.1 Gene:Neu2 / 40375 FlyBaseID:FBgn0037085 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001336738.1 Gene:ZNF7 / 7553 HGNCID:13139 Length:707 Species:Homo sapiens


Alignment Length:384 Identity:114/384 - (29%)
Similarity:156/384 - (40%) Gaps:76/384 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 CKSCLEDAQNAFDIIETYERSHQFYRFLKDVREEESENDGSGCSEEVEAAERDLQDGADDVDSGN 102
            |:.|.:..:...||...:|.:.|     |..|.:|.:...|.|          ||....:...|.
Human   219 CEECGKGIRATSDIALHWEINTQ-----KISRCQECQKKLSDC----------LQGKHTNNCHGE 268

  Fly   103 EP-DINECD--------------IKAKEKPGFSCSHCPKSFQVKSNLKVHMRSHTGERPFTCSLC 152
            :| :..||.              |...||| |.|:.|.|:|::.|.|..|.|.||||:|:.|..|
Human   269 KPYECAECGKVFRLCSQLNQHQRIHTGEKP-FKCTECGKAFRLSSKLIQHQRIHTGEKPYRCEEC 332

  Fly   153 PKSFGYSSGLQNHMRTHTGERPFQCSHCPRSFTAGHHLKAHIQMHERRGSLRCPYCQKCFLTSLI 217
            .|:||.||.|.:|.|.||||||:.|..|.::|:....|..|.:.|.......|..|.|.|..|..
Human   333 GKAFGQSSSLIHHQRIHTGERPYGCRECGKAFSQQSQLVRHQRTHTGERPYPCKECGKAFSQSST 397

  Fly   218 LKQHLATHTD-----------------------ETQFKCSQCSKSFQVEHELWMHMRVHQ-ERLF 258
            |.||...||.                       |..|||.:|.|:|:....|..|..:|. |:.:
Human   398 LAQHQRMHTGEKAQILKASDSPSLVAHQRIHAVEKPFKCDECGKAFRWISRLSQHQLIHTGEKPY 462

  Fly   259 TCGHCSKDFALHAYLKRHLSRNARCSQSSKASAHKTLGHSKALKCGKCPKTFTDRSALSTHLKSH 323
            .|..|:|.|...:.|.||               .:|....|..||.:|.|.|...|.|..|.:.|
Human   463 KCNKCTKAFGCSSRLIRH---------------QRTHTGEKPFKCDECGKGFVQGSHLIQHQRIH 512

  Fly   324 TKNKPLLEGPC----KSSGSKPAHSNAQR--KPFKCSSCPRTFSRKSALLTHLQTHTGK 376
            |..||.:...|    ..|.|...|....:  ||::|..|.:.||..:.|..|.:.|||:
Human   513 TGEKPYVCNDCGKAFSQSSSLIYHQRIHKGEKPYECLQCGKAFSMSTQLTIHQRVHTGE 571

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Neu2NP_649316.1 zf-AD 1..63 CDD:285071 6/24 (25%)
COG5048 <119..241 CDD:227381 52/144 (36%)
C2H2 Zn finger 121..141 CDD:275368 8/19 (42%)
zf-H2C2_2 133..158 CDD:290200 12/24 (50%)
C2H2 Zn finger 149..169 CDD:275368 10/19 (53%)
zf-H2C2_2 162..185 CDD:290200 11/22 (50%)
C2H2 Zn finger 177..197 CDD:275368 5/19 (26%)
C2H2 Zn finger 205..225 CDD:275368 8/19 (42%)
zf-C2H2_8 206..286 CDD:292531 27/103 (26%)
C2H2 Zn finger 233..253 CDD:275368 6/19 (32%)
C2H2 Zn finger 260..297 CDD:275368 8/36 (22%)
C2H2 Zn finger 303..323 CDD:275368 7/19 (37%)
C2H2 Zn finger 353..373 CDD:275368 6/19 (32%)
ZNF7NP_001336738.1 KRAB 25..86 CDD:214630
PHA02693 64..>137 CDD:333460
COG5048 239..696 CDD:227381 109/364 (30%)
C2H2 Zn finger 246..265 CDD:275368 5/28 (18%)
C2H2 Zn finger 273..293 CDD:275368 2/19 (11%)
C2H2 Zn finger 301..321 CDD:275368 8/19 (42%)
C2H2 Zn finger 329..349 CDD:275368 10/19 (53%)
C2H2 Zn finger 357..377 CDD:275368 5/19 (26%)
C2H2 Zn finger 385..405 CDD:275368 8/19 (42%)
C2H2 Zn finger 436..456 CDD:275368 6/19 (32%)
C2H2 Zn finger 464..484 CDD:275368 7/34 (21%)
C2H2 Zn finger 492..512 CDD:275368 7/19 (37%)
C2H2 Zn finger 520..540 CDD:275368 4/19 (21%)
C2H2 Zn finger 548..568 CDD:275368 6/19 (32%)
C2H2 Zn finger 576..596 CDD:275368
C2H2 Zn finger 604..624 CDD:275368
C2H2 Zn finger 657..677 CDD:275368
C2H2 Zn finger 685..705 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3991
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.