DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neu2 and CG5245

DIOPT Version :9

Sequence 1:NP_649316.1 Gene:Neu2 / 40375 FlyBaseID:FBgn0037085 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_650197.1 Gene:CG5245 / 41530 FlyBaseID:FBgn0038047 Length:501 Species:Drosophila melanogaster


Alignment Length:394 Identity:132/394 - (33%)
Similarity:186/394 - (47%) Gaps:60/394 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EPGLSIAYIIYKCTGWQVEKHDPL---SNTI-CKSCLEDAQNAF---DIIETYERSHQFYRFLKD 67
            ||...:...:..|.. ::.|..||   ::|. |..|    |..|   :.:|::.|.|        
  Fly    53 EPVKGVPSKLKTCKS-KIAKKRPLRKQTDTFKCTQC----QKTFTRKENLESHLRLH-------- 104

  Fly    68 VREEESENDGSGCSEEVEAAERDLQDGADDVDSGNEPDINECDIKAKEKPGFSCSHCPKSFQVKS 132
              .||...:.|.||:..                |.........:|.:::| ..||||.|:|...|
  Fly   105 --AEERPFECSHCSKSF----------------GRRTHYKRHLLKHEKRP-HKCSHCSKTFTQNS 150

  Fly   133 NLKVHMRSHTGERPFTCSLCPKSFGYSSGLQNHMRTHTGERPFQCSHCPRSFTAGHHLKAHIQMH 197
            :||.|:..|||||||.|:.|..||...|.||.|:|||:.||||:|:||.::|....||:.|::.|
  Fly   151 SLKQHLHEHTGERPFKCTQCSTSFARKSHLQVHLRTHSEERPFECTHCEKAFKNNSHLQEHLRTH 215

  Fly   198 ERRGSLRCPYCQKCFLTSLILKQHLATHTDETQFKCSQCSKSFQVEHELWMHMRVHQ-ERLFTCG 261
            :.....:|.:|.|.|....||::||.||. |..|||:||.|:|.....|.:|:|||. |..|.|.
  Fly   216 QEARPFKCSHCSKSFKLRSILQKHLLTHA-ERSFKCTQCPKTFLQNDSLQIHLRVHAGEDPFKCP 279

  Fly   262 HCSKDFALHAYLKRHLSRNA-----RCSQSSKASAHKTL--------GHSKALKCGKCPKTFTDR 313
            |||:.||.::.|:.||..:|     :|||.|...|.::|        ...:..||.:|.|:|..:
  Fly   280 HCSETFARNSRLQLHLLEHAGKEPLKCSQCSATFAMRSLYRVHVRLHTRERQYKCAECSKSFFKK 344

  Fly   314 SALSTHLKSHTKNKPLLEGPCKSSGSKPAH------SNAQRKPFKCSSCPRTFSRKSALLTHLQT 372
            |.|..|.:.||..:|.....|........|      .:...|..|||.|.:.|...|.||.|||.
  Fly   345 SHLVEHQQVHTGERPFKCTHCFKDFKCRTHLRVHMLDHIGEKVPKCSYCSKEFKLSSQLLVHLQE 409

  Fly   373 HTGK 376
            ||||
  Fly   410 HTGK 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Neu2NP_649316.1 zf-AD 1..63 CDD:285071 14/59 (24%)
COG5048 <119..241 CDD:227381 57/121 (47%)
C2H2 Zn finger 121..141 CDD:275368 10/19 (53%)
zf-H2C2_2 133..158 CDD:290200 14/24 (58%)
C2H2 Zn finger 149..169 CDD:275368 9/19 (47%)
zf-H2C2_2 162..185 CDD:290200 13/22 (59%)
C2H2 Zn finger 177..197 CDD:275368 7/19 (37%)
C2H2 Zn finger 205..225 CDD:275368 8/19 (42%)
zf-C2H2_8 206..286 CDD:292531 36/85 (42%)
C2H2 Zn finger 233..253 CDD:275368 8/19 (42%)
C2H2 Zn finger 260..297 CDD:275368 16/49 (33%)
C2H2 Zn finger 303..323 CDD:275368 7/19 (37%)
C2H2 Zn finger 353..373 CDD:275368 10/19 (53%)
CG5245NP_650197.1 COG5048 74..478 CDD:227381 128/372 (34%)
C2H2 Zn finger 84..104 CDD:275368 6/23 (26%)
C2H2 Zn finger 112..132 CDD:275368 4/35 (11%)
C2H2 Zn finger 139..159 CDD:275368 10/19 (53%)
C2H2 Zn finger 167..187 CDD:275368 9/19 (47%)
zf-H2C2_2 179..204 CDD:290200 14/24 (58%)
C2H2 Zn finger 195..215 CDD:275368 7/19 (37%)
C2H2 Zn finger 223..243 CDD:275368 8/19 (42%)
C2H2 Zn finger 250..270 CDD:275368 8/19 (42%)
C2H2 Zn finger 278..298 CDD:275368 9/19 (47%)
C2H2 Zn finger 306..326 CDD:275368 6/19 (32%)
C2H2 Zn finger 334..354 CDD:275368 7/19 (37%)
C2H2 Zn finger 362..382 CDD:275368 2/19 (11%)
C2H2 Zn finger 390..410 CDD:275368 10/19 (53%)
C2H2 Zn finger 418..438 CDD:275368
C2H2 Zn finger 446..466 CDD:275368
C2H2 Zn finger 474..492 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I1382
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D42822at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.060

Return to query results.
Submit another query.