DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neu2 and CG8301

DIOPT Version :9

Sequence 1:NP_649316.1 Gene:Neu2 / 40375 FlyBaseID:FBgn0037085 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_649915.1 Gene:CG8301 / 41160 FlyBaseID:FBgn0037717 Length:607 Species:Drosophila melanogaster


Alignment Length:447 Identity:109/447 - (24%)
Similarity:159/447 - (35%) Gaps:134/447 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VFDESHEPGLSIAYIIYKCTGWQVEKHDPLSNTICKSCLEDAQNAFDIIETYERSHQFYR-FLKD 67
            :.|||..|.|:|:|                   .||.||...:|           :|..: .|:.
  Fly   174 ITDESAPPQLTISY-------------------ACKFCLRPQEN-----------YQLQQLLLEH 208

  Fly    68 VREEESENDGSGCSEEVEAAERDLQDGADDVDSGNEPDINECDIKAK--EKPGFSCSHCPKSFQV 130
            :...........|.|    .|...||.|.          ....:|:.  ||. .:|..|.|.:..
  Fly   209 INASHDPEQPYNCPE----CEARFQDAAS----------RTVHLKSSHVEKQ-HACGVCGKKYGD 258

  Fly   131 KSNLKVHMRSHTGERPFTCSLCPKSFGYSSGLQNHMRTHTGERPFQCSH--CPRSFTAGHHLKAH 193
            :.||:.|:..:..|..|.|:||.|.|.....|..||:.|..:|.|:|.|  |.|.|.:..||..|
  Fly   259 RHNLRHHVEKYHSETDFECALCEKRFYTRKSLNYHMKWHNPDRQFKCRHSGCERLFISQRHLMCH 323

  Fly   194 IQMH---ERRGSLRCPYCQKCFLTSLILKQHL-ATHTDETQFKCSQCSKSFQVEHELWMHM---- 250
            ...|   ..|.|..|.:|.|.|:....|:.|: ..|..|..:||:.|::.|....|..:||    
  Fly   324 EATHSGTSSRKSEHCGFCGKTFIHLKTLRWHIYRQHGGEKPYKCANCTEVFASYAEKRIHMLERH 388

  Fly   251 ----------------------------------------------RVHQER-------LFTCGH 262
                                                          ||.|::       ||.||.
  Fly   389 RENLTAIERSECMLCRQPFSSEPDLIHHMSAEHLQRPGAPIIANNKRVLQQKRERQYSGLFQCGS 453

  Fly   263 CSKDFALHAYLKRHLSRNARCSQSSKASAHKTLGHSKALKCGKCPKTFTDRSALSTHLKSHTKNK 327
            ||:.|.:.:.|:||            |:.|.......|  |..|.|.|.....:..|:|:|.|.|
  Fly   454 CSQRFNMKSALERH------------AAVHSEKDRPHA--CPHCSKRFKRAQDMKWHIKTHEKEK 504

  Fly   328 PLLEGPCKSSGS--------KPAHSNAQRKPFKCSSCPRTFSRKSALLTHLQTHTGK 376
            |.:...|..:.:        :.:| ....|.|||:.|.|.:..:.:|..|.:|||||
  Fly   505 PNVCDVCGKAFALKYVLTQHRLSH-EVLEKNFKCNVCGRAYLFEKSLRLHQRTHTGK 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Neu2NP_649316.1 zf-AD 1..63 CDD:285071 13/58 (22%)
COG5048 <119..241 CDD:227381 41/127 (32%)
C2H2 Zn finger 121..141 CDD:275368 6/19 (32%)
zf-H2C2_2 133..158 CDD:290200 10/24 (42%)
C2H2 Zn finger 149..169 CDD:275368 8/19 (42%)
zf-H2C2_2 162..185 CDD:290200 10/24 (42%)
C2H2 Zn finger 177..197 CDD:275368 8/21 (38%)
C2H2 Zn finger 205..225 CDD:275368 6/20 (30%)
zf-C2H2_8 206..286 CDD:292531 27/137 (20%)
C2H2 Zn finger 233..253 CDD:275368 7/69 (10%)
C2H2 Zn finger 260..297 CDD:275368 10/36 (28%)
C2H2 Zn finger 303..323 CDD:275368 6/19 (32%)
C2H2 Zn finger 353..373 CDD:275368 5/19 (26%)
CG8301NP_649915.1 zf-AD 3..87 CDD:285071
COG5048 198..>508 CDD:227381 83/349 (24%)
C2H2 Zn finger 221..241 CDD:275368 7/33 (21%)
C2H2 Zn finger 249..269 CDD:275368 6/19 (32%)
C2H2 Zn finger 277..297 CDD:275368 8/19 (42%)
C2H2 Zn finger 305..327 CDD:275368 8/21 (38%)
C2H2 Zn finger 338..359 CDD:275368 6/20 (30%)
C2H2 Zn finger 367..384 CDD:275368 4/16 (25%)
C2H2 Zn finger 400..420 CDD:275368 0/19 (0%)
C2H2 Zn finger 451..471 CDD:275368 9/31 (29%)
C2H2 Zn finger 480..500 CDD:275368 6/19 (32%)
C2H2 Zn finger 508..528 CDD:275368 1/19 (5%)
C2H2 Zn finger 537..557 CDD:275368 5/19 (26%)
C2H2 Zn finger 565..582 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446563
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I1382
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.980

Return to query results.
Submit another query.