DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neu2 and CG10274

DIOPT Version :9

Sequence 1:NP_649316.1 Gene:Neu2 / 40375 FlyBaseID:FBgn0037085 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001097525.1 Gene:CG10274 / 38716 FlyBaseID:FBgn0035690 Length:863 Species:Drosophila melanogaster


Alignment Length:488 Identity:100/488 - (20%)
Similarity:146/488 - (29%) Gaps:214/488 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 HQFYRFLKDVREEE---SEND-----------------GSGCSEEVEAAERDLQDGADDVDSGNE 103
            ||  :|.|.:|.||   ..||                 ..|....::.|..:|.           
  Fly   275 HQ--KFKKAIRYEEHMKHHNDLLPFQCKVETCRKGFTTAGGLRLHIDHAHTELS----------- 326

  Fly   104 PDINECDI------------------------KAKEKP-GFSCSHCPKSFQVKSNLKVHMRSHTG 143
             :::.|::                        ||...| .:.|:.|.|.|:....||.||..|.|
  Fly   327 -EVHSCNVDGCGKTFPRIRLLTFHMKKMHGITKAAAPPRDYPCTECEKVFRCPMALKKHMYKHDG 390

  Fly   144 -ERPFTCSLCPKSFGYSSGLQNHMR----------------------------THTGERPFQCSH 179
             |.||.|::|.|.|..:|.|::|:.                            |||.|:.|:|..
  Fly   391 KELPFPCNICGKRFVINSALKDHLMRHAGIKNYVCPYCGVGKTTRQEWNTHILTHTQEKKFKCHI 455

  Fly   180 CPRSFTAGHHLKAHIQ-MHERRGSLRCPYCQKCFLTSLILKQHLATHTDETQFKCSQCSKSFQVE 243
            |..:......|..||: :||:..:..|.||.|.|..|...|.|..|||.|.:.:|..|.|.|...
  Fly   456 CEHASHNKQSLANHIKIVHEKIKNYACQYCGKTFGKSHACKIHEMTHTGEKRCECKVCGKKFLYP 520

  Fly   244 HELWMHMRVHQERLFTCGHCSKDFALHAYLKRH---------------------------LSRNA 281
            ..|..|::.|::|:..        |:..|.:|.                           :||||
  Fly   521 KSLTKHLKTHEKRVLR--------AIETYRQRQVEMGETPGEQFDNPPAPPVEGISIEPIMSRNA 577

  Fly   282 R------CSQS------------------------------------------------------ 286
            .      |::|                                                      
  Fly   578 ADELLKVCAESVATIPKDPRRVQRVDLAQLAGTAVNPIPSVSVPSWSPQVNFTKKEGKHICPGCG 642

  Fly   287 ------SKASAHKTLGHSKA--LKCGKCPKTFTDRSALSTHLKSHTKNKPLLEGPCKSSGSKPAH 343
                  .....|..:.|.|.  ..|..|||.|.....|..|...||                   
  Fly   643 QGFNNIGNMKRHYKIIHEKVKDFACRFCPKRFAKAQTLRHHEWIHT------------------- 688

  Fly   344 SNAQRKPFKCSSCPRTFSRKSALLTHLQTHTGK 376
               ..|||:|.:|...|.:::||..|.:||..:
  Fly   689 ---GEKPFECKTCGTHFRQETALKRHQRTHENR 718

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Neu2NP_649316.1 zf-AD 1..63 CDD:285071 2/3 (67%)
COG5048 <119..241 CDD:227381 47/151 (31%)
C2H2 Zn finger 121..141 CDD:275368 8/19 (42%)
zf-H2C2_2 133..158 CDD:290200 13/25 (52%)
C2H2 Zn finger 149..169 CDD:275368 7/47 (15%)
zf-H2C2_2 162..185 CDD:290200 9/50 (18%)
C2H2 Zn finger 177..197 CDD:275368 5/20 (25%)
C2H2 Zn finger 205..225 CDD:275368 8/19 (42%)
zf-C2H2_8 206..286 CDD:292531 27/112 (24%)
C2H2 Zn finger 233..253 CDD:275368 6/19 (32%)
C2H2 Zn finger 260..297 CDD:275368 10/129 (8%)
C2H2 Zn finger 303..323 CDD:275368 7/19 (37%)
C2H2 Zn finger 353..373 CDD:275368 6/19 (32%)
CG10274NP_001097525.1 zf-AD 15..90 CDD:214871
C2H2 Zn finger 334..353 CDD:275368 0/18 (0%)
C2H2 Zn finger 368..388 CDD:275368 8/19 (42%)
COG5048 394..729 CDD:227381 73/355 (21%)
C2H2 Zn finger 397..417 CDD:275368 7/19 (37%)
C2H2 Zn finger 425..445 CDD:275368 0/19 (0%)
C2H2 Zn finger 453..474 CDD:275368 5/20 (25%)
C2H2 Zn finger 482..502 CDD:275368 8/19 (42%)
C2H2 Zn finger 510..530 CDD:275368 6/19 (32%)
C2H2 Zn finger 638..659 CDD:275368 1/20 (5%)
C2H2 Zn finger 667..687 CDD:275368 7/19 (37%)
zf-H2C2_2 680..704 CDD:290200 10/45 (22%)
C2H2 Zn finger 695..715 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446567
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.