DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neu2 and CG10543

DIOPT Version :9

Sequence 1:NP_649316.1 Gene:Neu2 / 40375 FlyBaseID:FBgn0037085 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001369100.1 Gene:CG10543 / 37379 FlyBaseID:FBgn0034570 Length:1666 Species:Drosophila melanogaster


Alignment Length:359 Identity:95/359 - (26%)
Similarity:149/359 - (41%) Gaps:76/359 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 DVREEESENDGSGCSEEVEAAERDLQDGADDVD-----------SGNEPDINECDIKAKEKPGFS 120
            |:..:|.::|.....:|::||::.|.||.....           ||:.....:.....|:||.::
  Fly   662 DLSADEDDDDLDHDLDELDAAKQQLIDGGSSSSTSLQAPPSQHGSGSGGSGGQTPGSKKDKPSYN 726

  Fly   121 CSHCPKSFQVKSNLKVHMRSHTGERPFTCSLCPKSFGYS-SGLQNHMRT-HTGERPFQCSHCPRS 183
            |..||||::.:.:|..|.:.|.|    .|..|.:..|.: ..:.:|.|| |..|.||.|..|..|
  Fly   727 CLLCPKSYRKRKSLLDHYKMHPG----YCHDCGQRNGNTLEEIIHHNRTMHVKEFPFVCETCGES 787

  Fly   184 FTAGHHLKAHIQMHERRGSLRCPYCQKCFLTSLILKQHLATHTDETQFK-----CSQCSKSFQVE 243
            ::......||::.|.::.....| |.:|.|.  ..::.|..|.:||..|     |..|.:.||.:
  Fly   788 YSRKQQFHAHVESHNKKEIKTFP-CGECGLK--FPQKKLQQHFEETGHKADGAICEVCGEEFQSK 849

  Fly   244 HELWMH-MRVH-QERLFTCGHCSKDFALHAYLKRHLSRNAR---------CSQS---------SK 288
            :.|:.| :||| ::..|.|..|...|.|.|.|:||:..:..         |..|         ..
  Fly   850 NALYQHIIRVHKRDNFFECHICHNRFTLKANLERHVQLHTEIKRPYVCDLCGSSYFTYPALKEHY 914

  Fly   289 ASAHKTLGHSKALKCGKCPKTFTDRSALSTHLKSHTKNKPLLEGPCKSSGSKPAHSNAQRKPFKC 353
            ::||..:..   .||..|.|.|....:|..||.||::.:|              |.        |
  Fly   915 SNAHVDVSE---CKCTLCGKRFGSAKSLQRHLPSHSEERP--------------HC--------C 954

  Fly   354 SSCPRTFSRKSALLTHLQTHTG------KLGTNR 381
            :.|.:||..|:.|:.|.||..|      |.|..|
  Fly   955 NYCDQTFKWKTHLVRHKQTMHGNEPPPPKKGKQR 988

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Neu2NP_649316.1 zf-AD 1..63 CDD:285071
COG5048 <119..241 CDD:227381 36/128 (28%)
C2H2 Zn finger 121..141 CDD:275368 7/19 (37%)
zf-H2C2_2 133..158 CDD:290200 6/24 (25%)
C2H2 Zn finger 149..169 CDD:275368 6/21 (29%)
zf-H2C2_2 162..185 CDD:290200 10/23 (43%)
C2H2 Zn finger 177..197 CDD:275368 5/19 (26%)
C2H2 Zn finger 205..225 CDD:275368 5/19 (26%)
zf-C2H2_8 206..286 CDD:292531 28/95 (29%)
C2H2 Zn finger 233..253 CDD:275368 7/20 (35%)
C2H2 Zn finger 260..297 CDD:275368 12/54 (22%)
C2H2 Zn finger 303..323 CDD:275368 7/19 (37%)
C2H2 Zn finger 353..373 CDD:275368 8/19 (42%)
CG10543NP_001369100.1 C2H2 Zn finger 727..747 CDD:275368 7/19 (37%)
C2H2 Zn finger 751..773 CDD:275368 6/21 (29%)
C2H2 Zn finger 781..801 CDD:275368 5/19 (26%)
PHA00733 <804..860 CDD:177301 16/58 (28%)
C2H2 Zn finger 811..827 CDD:275368 4/17 (24%)
C2H2 Zn finger 839..860 CDD:275368 7/20 (35%)
C2H2 Zn finger 868..888 CDD:275368 8/19 (42%)
C2H2 Zn finger 897..913 CDD:275368 2/15 (13%)
C2H2 Zn finger 926..946 CDD:275368 7/19 (37%)
C2H2 Zn finger 954..975 CDD:275368 9/20 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.