DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neu2 and CG30431

DIOPT Version :9

Sequence 1:NP_649316.1 Gene:Neu2 / 40375 FlyBaseID:FBgn0037085 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster


Alignment Length:420 Identity:105/420 - (25%)
Similarity:157/420 - (37%) Gaps:113/420 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SVFDESHEPGLSIAYIIYKCTGWQVEKHDPLSNTICKSCLEDAQNAFDIIETYERSHQFYRF--- 64
            |::|.|.:..:.:..:   ....::|..|.|::.||..||....:|.|.....|.|.|..|.   
  Fly    25 SLYDASSQLAVELKAL---APALRLEHGDNLTDVICDLCLRRLHDARDFQRRCEHSEQVLRMRHE 86

  Fly    65 -------------LKDVREEESENDGS-------------------GCSEEVEAAERDLQDGA-- 95
                         |.||.|......||                   ...|.|:....|.||.:  
  Fly    87 HWKHTVAVGDALALDDVLECLEREVGSLEGPMSVPLQASKPVAHVAPLMETVDFESLDFQDSSHS 151

  Fly    96 ---------DDVDSG------NEPDINE-------CDIKAKEKPGFSCSHCPKSFQVK---SNLK 135
                     ..||||      ::|:..|       ...::.|:|....:..||..:.:   .|:|
  Fly   152 EHDIPSYWESSVDSGSLNTPHHQPETAELFAVEPPTPPESSEEPAPDAAEKPKMRRARPRQDNVK 216

  Fly   136 ---------VHMRS-HTGERPFTCSLCPKSFGYSSGLQNHM-RTH-TGERPFQCSHCPRSFTAGH 188
                     ||.|| |      .|..|.|.|..:..|:.|| ..| .||..:||..|.::|.:.|
  Fly   217 PKERKASGAVHPRSLH------PCPECEKKFTRNFQLKLHMTAVHGMGEMRYQCEECRKNFASRH 275

  Fly   189 HLKAHIQ-MHERRGSLRCPYCQKCFLTSLILKQHLATHTDETQ---FKCSQCSKSFQVEHELWMH 249
            .|:.|:: :|.......|.:|.:.|:....|..||.|||.|.:   |:|.:||||:..:.:|..|
  Fly   276 SLRYHVKSVHSTERPFGCQHCDRRFILRTQLLSHLRTHTGEAKPRIFECQRCSKSWPTKSDLRTH 340

  Fly   250 MRVH---QERLFTCGHCSKDFALHAYLKRHLSRNARCSQSSKASAHKTLGHS--KALKCGKCPKT 309
            ||.|   .||.|.|..|||.|....:|..||                 |.|:  |...|..|.|.
  Fly   341 MRSHNPNMERPFKCDRCSKAFFTRGHLNSHL-----------------LVHTGEKPFACEYCDKC 388

  Fly   310 FTDRSALSTHL-KSHTKNKPLLEGPCKSSG 338
            :.....|:.|: :.|.   .::|...::.|
  Fly   389 YQSVGNLNNHMVRLHA---DIIEAQLEAEG 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Neu2NP_649316.1 zf-AD 1..63 CDD:285071 15/59 (25%)
COG5048 <119..241 CDD:227381 43/140 (31%)
C2H2 Zn finger 121..141 CDD:275368 8/32 (25%)
zf-H2C2_2 133..158 CDD:290200 11/34 (32%)
C2H2 Zn finger 149..169 CDD:275368 7/20 (35%)
zf-H2C2_2 162..185 CDD:290200 9/24 (38%)
C2H2 Zn finger 177..197 CDD:275368 6/20 (30%)
C2H2 Zn finger 205..225 CDD:275368 6/19 (32%)
zf-C2H2_8 206..286 CDD:292531 31/85 (36%)
C2H2 Zn finger 233..253 CDD:275368 9/19 (47%)
C2H2 Zn finger 260..297 CDD:275368 9/36 (25%)
C2H2 Zn finger 303..323 CDD:275368 5/20 (25%)
C2H2 Zn finger 353..373 CDD:275368
CG30431NP_610211.1 zf-AD 11..82 CDD:285071 15/59 (25%)
C2H2 Zn finger 234..255 CDD:275368 7/20 (35%)
C2H2 Zn finger 264..285 CDD:275368 6/20 (30%)
C2H2 Zn finger 293..313 CDD:275368 6/19 (32%)
zf-C2H2_8 305..373 CDD:292531 29/84 (35%)
C2H2 Zn finger 324..344 CDD:275368 9/19 (47%)
C2H2 Zn finger 354..374 CDD:275368 9/36 (25%)
zf-H2C2_2 366..389 CDD:290200 9/39 (23%)
C2H2 Zn finger 382..403 CDD:275368 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446592
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.