DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neu2 and CG4496

DIOPT Version :9

Sequence 1:NP_649316.1 Gene:Neu2 / 40375 FlyBaseID:FBgn0037085 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001285707.1 Gene:CG4496 / 34000 FlyBaseID:FBgn0031894 Length:580 Species:Drosophila melanogaster


Alignment Length:442 Identity:97/442 - (21%)
Similarity:145/442 - (32%) Gaps:161/442 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 EDAQNAFDIIETYERS-------------------HQFYRFLKDVREEESEND-GSGCSEEVE-- 85
            |:||:...:|.:..||                   .:.:|.:.::...:|::| .|...|:|.  
  Fly   116 EEAQSPRGLIISAARSLAHWNSSIRRVTPDIELIPRRVHRVVAEIELSDSDHDEDSEVDEDVSLP 180

  Fly    86 ------AAERDLQDGADD------VDSGNEPDINECD--IK---------AKEKPG--------F 119
                  ......|||:.:      :...::.|..:.|  ||         .|.:||        :
  Fly   181 SNAVSCVLNEQRQDGSQNPQELVIIVPSDQEDEQKTDNVIKRKSSGSRRLVKRRPGANRRGRHMY 245

  Fly   120 SCSHCPKSFQVKSNLKVHMRSHTGERPFTCSLCPKSFGYSSGLQNHMRTHTGERPFQCSHC---- 180
            .|..|.|..|...||:.||..|||||||.|.||.:.|...|.|:.|.|.|:.:..|.|..|    
  Fly   246 ECPDCGKKVQSNYNLRRHMMIHTGERPFPCDLCERRFREFSDLKKHRRRHSHDPQFICMICHLGA 310

  Fly   181 ----------------------------------------------------------------- 180
                                                                             
  Fly   311 PLEQDSTRCADCESKNLMVKPQPEELGEKTTEEHSDEMEGDDDEIEEAALENEKQPQVATQPSLM 375

  Fly   181 -------------------------PRSFTAGHHLK--------AHIQMHERRGSLRCPYCQKCF 212
                                     |||.::.:...        |...|...|.|..||.|.:.|
  Fly   376 VTLIPPIQSPPEKVPSHTQPSRPPLPRSCSSANSSSSLSNDGNIAGKSMSRTRRSYPCPLCHRPF 440

  Fly   213 LTSLILKQHLATHTDETQFKCSQCSKSFQVEHELWMHMRVH-QERLFTCGHCSKDFALHAYLKRH 276
            .|...||:|...||.|..|.||:|.|.|:....|..||..| ::|.:.|..|...|..:.....|
  Fly   441 GTRHNLKRHYMIHTGEKPFSCSKCRKPFRECSTLKKHMVTHVRDRWYKCLRCPSKFRDYLEYSDH 505

  Fly   277 LSRNARCSQSSKASAHKT--LGHSK---ALKCGKCPKTFTDRSALSTHLKSH 323
            .:.:.....|.|:|.:::  .|.|.   .|:|.:|.:.||:..|.:.|||.|
  Fly   506 KNNHQDQLSSRKSSIYESDDDGDSSVEDCLECCECQQRFTELDAYTAHLKKH 557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Neu2NP_649316.1 zf-AD 1..63 CDD:285071 6/38 (16%)
COG5048 <119..241 CDD:227381 50/223 (22%)
C2H2 Zn finger 121..141 CDD:275368 8/19 (42%)
zf-H2C2_2 133..158 CDD:290200 15/24 (63%)
C2H2 Zn finger 149..169 CDD:275368 8/19 (42%)
zf-H2C2_2 162..185 CDD:290200 10/116 (9%)
C2H2 Zn finger 177..197 CDD:275368 6/121 (5%)
C2H2 Zn finger 205..225 CDD:275368 8/19 (42%)
zf-C2H2_8 206..286 CDD:292531 25/80 (31%)
C2H2 Zn finger 233..253 CDD:275368 8/19 (42%)
C2H2 Zn finger 260..297 CDD:275368 7/38 (18%)
C2H2 Zn finger 303..323 CDD:275368 8/19 (42%)
C2H2 Zn finger 353..373 CDD:275368
CG4496NP_001285707.1 zf-C2H2 245..267 CDD:278523 8/21 (38%)
C2H2 Zn finger 247..267 CDD:275368 8/19 (42%)
zf-H2C2_2 259..282 CDD:290200 14/22 (64%)
C2H2 Zn finger 275..295 CDD:275368 8/19 (42%)
zf-C2H2 431..453 CDD:278523 8/21 (38%)
C2H2 Zn finger 433..453 CDD:275368 8/19 (42%)
zf-H2C2_2 445..468 CDD:290200 11/22 (50%)
C2H2 Zn finger 461..481 CDD:275368 8/19 (42%)
C2H2 Zn finger 489..510 CDD:275368 4/20 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.