DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neu2 and CG17612

DIOPT Version :9

Sequence 1:NP_649316.1 Gene:Neu2 / 40375 FlyBaseID:FBgn0037085 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_608824.1 Gene:CG17612 / 33639 FlyBaseID:FBgn0031597 Length:618 Species:Drosophila melanogaster


Alignment Length:402 Identity:126/402 - (31%)
Similarity:168/402 - (41%) Gaps:94/402 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASVFDESHEPGLSIAYIIYKCTGWQVEKHDPLSNTICKSCLEDAQNAFDIIETYERSHQFYRFL 65
            :.::||::|:.|:.||.|:.:.||..|||.|..|..||.:||:..:||||.:|:.|.:.|.||..
  Fly   197 LTNIFDDAHQYGIPIATILSQYTGMPVEKGDSFSEYICVTCLDVVKNAFDDLESKENTIQMYRQP 261

  Fly    66 KDVREEESENDGSGCSEEVEAAERDLQDGADDVDS---GNEPDINECDIKAKEKPGFSCSHCPKS 127
            |               ||:           .|:||   .|:|    .|.:...||...|..|||.
  Fly   262 K---------------EEI-----------IDIDSIPVKNKP----VDYEVTGKPPHRCPQCPKI 296

  Fly   128 FQVKSNLKVHMRSH----TGERP-FTCSLCPKSFGYSSGLQNHMRTHTG--------ERPFQCSH 179
            |.:.:.|:.|:|:|    |.|.| ..|.:||..:.....|:.||..|..        |.|::|.|
  Fly   297 FLLAAKLQAHIRTHNETRTTEPPRLKCPMCPSIYMKRGCLEAHMWIHRASDERESELEPPYRCPH 361

  Fly   180 CPRSFTAGHHLKAHIQMHE-------RRGSLRCPYCQKCFLTSLILKQHLATHTDETQFKCSQCS 237
            ||:.|.....|:.|||.||       |:.|.:|..|...|.....||.|:..|..|..|||..|.
  Fly   362 CPKLFLYSSFLEIHIQTHEDVSQRLSRKSSHKCAQCADVFSDVSSLKDHVKIHAGERTFKCPLCL 426

  Fly   238 KSFQVEHELWMHMRVHQERLFTCGHCSKDFALHAYLKRHLSRNARCSQSSKASAHKTLGHSKALK 302
            .|||.|..|..|...|..  |.|..|||.|....||..|..:           :|.|.|   ..|
  Fly   427 MSFQEESNLKSHDCAHTR--FKCHKCSKFFESQNYLDFHFKK-----------SHTTKG---PFK 475

  Fly   303 CGKCPKTFTDRSALSTHLKSHTKNKPLLEGPC------KSSGSKPAHSNAQRKPFKCSSCPRTFS 361
            |.||.:||..|:.|..|:.|..         |      ||.|          :.|.|..||:.||
  Fly   476 CIKCQQTFQKRNGLKEHISSQV---------CVQFLRSKSPG----------QIFPCPKCPKKFS 521

  Fly   362 RKSALLTHLQTH 373
            .:.....|..||
  Fly   522 IEDNYQMHHATH 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Neu2NP_649316.1 zf-AD 1..63 CDD:285071 25/61 (41%)
COG5048 <119..241 CDD:227381 47/141 (33%)
C2H2 Zn finger 121..141 CDD:275368 8/19 (42%)
zf-H2C2_2 133..158 CDD:290200 10/29 (34%)
C2H2 Zn finger 149..169 CDD:275368 6/19 (32%)
zf-H2C2_2 162..185 CDD:290200 10/30 (33%)
C2H2 Zn finger 177..197 CDD:275368 9/19 (47%)
C2H2 Zn finger 205..225 CDD:275368 6/19 (32%)
zf-C2H2_8 206..286 CDD:292531 27/79 (34%)
C2H2 Zn finger 233..253 CDD:275368 8/19 (42%)
C2H2 Zn finger 260..297 CDD:275368 10/36 (28%)
C2H2 Zn finger 303..323 CDD:275368 8/19 (42%)
C2H2 Zn finger 353..373 CDD:275368 6/19 (32%)
CG17612NP_608824.1 zf-AD 187..>246 CDD:285071 20/48 (42%)
C2H2 Zn finger 290..310 CDD:275368 8/19 (42%)
C2H2 Zn finger 323..343 CDD:275370 6/19 (32%)
zf-C2H2_8 356..438 CDD:292531 31/81 (38%)
C2H2 Zn finger 359..379 CDD:275368 9/19 (47%)
C2H2 Zn finger 394..414 CDD:275368 6/19 (32%)
C2H2 Zn finger 422..438 CDD:275368 7/15 (47%)
C2H2 Zn finger 447..463 CDD:275368 7/15 (47%)
C2H2 Zn finger 476..505 CDD:275368 10/37 (27%)
C2H2 Zn finger 513..533 CDD:275368 6/19 (32%)
C2H2 Zn finger 545..565 CDD:275368
C2H2 Zn finger 568..584 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446574
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 116 1.000 Inparanoid score I3381
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.890

Return to query results.
Submit another query.