DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neu2 and CG1529

DIOPT Version :10

Sequence 1:NP_649316.1 Gene:Neu2 / 40375 FlyBaseID:FBgn0037085 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001138223.2 Gene:CG1529 / 33077 FlyBaseID:FBgn0031144 Length:512 Species:Drosophila melanogaster


Alignment Length:328 Identity:91/328 - (27%)
Similarity:134/328 - (40%) Gaps:42/328 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KCTGWQVEKHDPLSNTICKSCLEDAQNAFDIIETYERS-HQFYRFLKDVREEESENDGSGCSEEV 84
            |..|||     |:...:.:...|.....  :.|.:|.: |:.        |||.|....|...::
  Fly    78 KLIGWQ-----PVDIAVDRVKEEPPDEG--LKENHEENEHEL--------EEEHEKQADGQQVDL 127

  Fly    85 EAAERDLQDGADDVDSGNEPDINECDIK-------AKEKPGFSCSHCPKSFQVKSNLKVHMRS-H 141
            ...:.|.:...||.:....||..|...:       :|.:.|.:|..|.|.......|:.|:|| |
  Fly   128 SKKQEDQKKILDDREDEEYPDEYENSQQQLSQGTGSKRRAGLACDQCGKQVYKLPYLEAHIRSVH 192

  Fly   142 TG-ERPFTCSLCPKSFGYSSGLQNHMRTHTGE--------RPFQCSHCPRSFTAGHHLKAHIQMH 197
            .| .:||.|..|.|||.....|::|||....:        |...|..|.|.::..:.|..|::.|
  Fly   193 QGYSKPFLCRSCDKSFTRYEQLRSHMRNAHPQLEQLQQELRDLICELCNRQYSTKNALGEHLKRH 257

  Fly   198 ERRGSLRCPYCQKCFLTSLILKQHLATHTDE-TQFKCSQCSKSFQVEHELWMHMR-VHQ-ERLFT 259
            .:|....|.:|....:|...|..||.||... .:|||.||.:.|:.:..:..|:| ||: :|.|.
  Fly   258 AQRKEHVCEHCGVAKVTRTELLTHLRTHNPTWERFKCEQCPQLFRHKSAISRHVRVVHEGQRRFQ 322

  Fly   260 CGHCSKDFALHAYLKRHLSRNARCSQSSKASAHKTLGHSKALKCGKCPKTFTDRSALSTHLKSHT 324
            ||||.|.|..||...||...:...:.|.:|:      ......|..|.|....|..|..||:.|.
  Fly   323 CGHCEKKFGTHASQVRHERLHTESTGSGEAA------EEWPFACIHCQKPCVSRQTLELHLRRHR 381

  Fly   325 KNK 327
            ..|
  Fly   382 ARK 384

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Neu2NP_649316.1 zf-AD 1..63 CDD:462262 9/42 (21%)
COG5048 <119..241 CDD:227381 41/132 (31%)
C2H2 Zn finger 121..141 CDD:275368 7/20 (35%)
zf-H2C2_2 133..156 CDD:463886 11/24 (46%)
C2H2 Zn finger 149..169 CDD:275368 9/19 (47%)
zf-H2C2_2 162..185 CDD:463886 8/30 (27%)
C2H2 Zn finger 177..197 CDD:275368 5/19 (26%)
C2H2 Zn finger 205..225 CDD:275368 6/19 (32%)
zf-C2H2_8 206..286 CDD:464935 29/82 (35%)
C2H2 Zn finger 233..253 CDD:275368 6/20 (30%)
C2H2 Zn finger 260..297 CDD:275368 12/36 (33%)
C2H2 Zn finger 303..323 CDD:275368 7/19 (37%)
C2H2 Zn finger 353..373 CDD:275368