DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neu2 and CG18262

DIOPT Version :9

Sequence 1:NP_649316.1 Gene:Neu2 / 40375 FlyBaseID:FBgn0037085 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_572453.1 Gene:CG18262 / 31745 FlyBaseID:FBgn0030012 Length:469 Species:Drosophila melanogaster


Alignment Length:411 Identity:96/411 - (23%)
Similarity:149/411 - (36%) Gaps:114/411 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 SNTICKSCLEDAQNAFDIIET---------------------------------YERSHQFYRFL 65
            |:::|.:.||....|.|::|.                                 |:|:......|
  Fly    59 SSSLCSNELESDPIAQDVVEVQGNEELHEELAKEASPDLEEEEEEKEEGSKRQHYQRAAAMKNTL 123

  Fly    66 KDVRE------------EESENDGSGCSEEVEAAERDLQDGADDVD------------------- 99
            .:.||            |:||::.:...||.|:.:.|.:|..|..|                   
  Fly   124 VETREDLLDIELDWTGGEQSEHNETHEEEEGESDDDDTKDSNDTKDMLFQCDQCDRAYNTKRSLQ 188

  Fly   100 ----------SGNEPDINECDIKAKEKPG----FSCSH--CPKSFQVKSNLKVHMRSHTGERPFT 148
                      :|...|.:..:..:|::.|    :.|:.  |.::|:.:.:|:.|...|||   ..
  Fly   189 SHRRLKHSEANGGSLDKSASERNSKKRKGPPKVYKCNEEACNQTFRTERDLRGHRWKHTG---IF 250

  Fly   149 CSLCPKSFGYSSGLQNHMRTHTGERPFQCSHCPRSFTAGHHLKAHIQMHERRGSLRCPYCQKCFL 213
            |.:|.|.|..|..:..|.:.|:|.:|.:|..|..:|.....|.:|...|..|....|..|.:...
  Fly   251 CDICGKPFTQSGNMMRHRQRHSGIKPHKCPECDATFYTQKELSSHSICHTGRMPCICEVCGRPCR 315

  Fly   214 TSLILKQHLATHTDETQFKCSQCSKSFQVEHELWMHMRVHQE-RLFTCGHCSKDFALHAYLKRHL 277
            ...:|..|:..||.|...||..|.|:|...|:|.:|...|.. |.|.|..|...|          
  Fly   316 DRGVLTAHMRRHTGERPAKCEVCGKAFYSFHDLNVHAVSHTNLRPFVCDVCGSTF---------- 370

  Fly   278 SRNARCSQSSKA-SAHKTLGHSKALK--CGKCPKTFTDRSALSTHLKSHTKNKPLLEGPCKSSGS 339
                   |..|| ..||.| ||:..|  |..|.|||.....|:.|::||        .|.:..|:
  Fly   371 -------QRKKALRVHKLL-HSEQRKYACKLCGKTFAQSGGLNAHMRSH--------DPARVKGA 419

  Fly   340 -KPAHSNAQRKPFKCSSCPRT 359
             ||...:...:..:..|.|.|
  Fly   420 VKPLPQSVTIEVIEGKSPPTT 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Neu2NP_649316.1 zf-AD 1..63 CDD:285071 9/61 (15%)
COG5048 <119..241 CDD:227381 35/123 (28%)
C2H2 Zn finger 121..141 CDD:275368 5/21 (24%)
zf-H2C2_2 133..158 CDD:290200 9/24 (38%)
C2H2 Zn finger 149..169 CDD:275368 6/19 (32%)
zf-H2C2_2 162..185 CDD:290200 6/22 (27%)
C2H2 Zn finger 177..197 CDD:275368 5/19 (26%)
C2H2 Zn finger 205..225 CDD:275368 4/19 (21%)
zf-C2H2_8 206..286 CDD:292531 20/80 (25%)
C2H2 Zn finger 233..253 CDD:275368 7/19 (37%)
C2H2 Zn finger 260..297 CDD:275368 9/37 (24%)
C2H2 Zn finger 303..323 CDD:275368 7/19 (37%)
C2H2 Zn finger 353..373 CDD:275368 3/7 (43%)
CG18262NP_572453.1 C2H2 Zn finger 224..246 CDD:275368 5/21 (24%)
C2H2 Zn finger 251..271 CDD:275368 6/19 (32%)
COG5048 <256..415 CDD:227381 54/184 (29%)
zf-H2C2_2 263..288 CDD:290200 7/24 (29%)
C2H2 Zn finger 279..327 CDD:275368 11/47 (23%)
zf-H2C2_2 320..342 CDD:290200 9/21 (43%)
C2H2 Zn finger 335..355 CDD:275368 7/19 (37%)
C2H2 Zn finger 363..383 CDD:275368 9/37 (24%)
zf-C2H2 389..411 CDD:278523 7/21 (33%)
C2H2 Zn finger 391..411 CDD:275368 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446564
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.