DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neu2 and CG3032

DIOPT Version :9

Sequence 1:NP_649316.1 Gene:Neu2 / 40375 FlyBaseID:FBgn0037085 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001284974.1 Gene:CG3032 / 31648 FlyBaseID:FBgn0029928 Length:431 Species:Drosophila melanogaster


Alignment Length:422 Identity:106/422 - (25%)
Similarity:149/422 - (35%) Gaps:120/422 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VEKHDP----LSNTICKSCLEDAQNAFDIIETYERS-----HQFYRFL-KDVREEESENDGSGCS 81
            ||..|.    |.|.:|..|....||    .|.:.|.     .|....| ||.||...|....|..
  Fly    53 VENQDADQQWLPNELCLECRSAVQN----FEKFRRKADECRKQLLEMLKKDPREPTFEVVYDGRE 113

  Fly    82 EEVEAAERDLQDGADDVDSGNEPD-INECDIKAKEKPGFS---------CSHCPKSFQVKSNLKV 136
            |:.|:..     |.:..:...:|| |:|..||:.:.|..|         ||.|.:||..:..|..
  Fly   114 EDQESLH-----GLEPPEPAPDPDPIDEPAIKSDKSPRKSFRGSRNTLKCSVCRRSFAHQITLAA 173

  Fly   137 HMRS-HTG-ERPFTCSLCPKSFGYSSGLQNHM--------RTHTGERP----------------- 174
            |:|. |.| :|||.|..|.|::.:..||..|:        |.|..::|                 
  Fly   174 HIRKVHEGSKRPFQCDQCEKAYSFMGGLYTHIREVHAPKERRHPCDQPGCERIYTSRIAMQKHKR 238

  Fly   175 -------------FQCSHCPRSFTAGHHLKAHI--------QMHERRGSLR----CPYCQKCFLT 214
                         |.|..|..||....:||.|:        ::..|.|...    |..|||.|.:
  Fly   239 LKHSPRDRDALKKFICEQCGASFNQSANLKYHLKTKHPTEDEVAAREGGAGERHFCDICQKEFHS 303

  Fly   215 SLILKQH-LATH--TDETQFKCSQCSKSFQVEHELWMHMRVHQERLFTCGHCSKDFALHAYLKRH 276
            ...||.| |..|  .:|...:|..|.:....:..|..||.:|......|.||.:.||....|:.|
  Fly   304 RYTLKYHTLQQHEVQEELPHECQVCGRRMAKKFMLLQHMLMHSNDKLPCEHCGRRFARRFELEAH 368

  Fly   277 LSRNARCSQSSKASAHKTLGHSKALKCGKCPKTFTDRSALSTHLKSHTKNKPLLEGPCKSSGSKP 341
            :           .:.|..|   |...|..||::|..|..|..|...||..||.:           
  Fly   369 V-----------RAVHLKL---KPFPCHHCPESFASRKTLRHHEYIHTGEKPYI----------- 408

  Fly   342 AHSNAQRKPFKCSSCPRTFSRKSALLTHLQTH 373
                       |.:|.:.|.:::.|..|.:.|
  Fly   409 -----------CDTCGQAFRQQTCLKNHRKVH 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Neu2NP_649316.1 zf-AD 1..63 CDD:285071 12/44 (27%)
COG5048 <119..241 CDD:227381 46/185 (25%)
C2H2 Zn finger 121..141 CDD:275368 8/20 (40%)
zf-H2C2_2 133..158 CDD:290200 11/26 (42%)
C2H2 Zn finger 149..169 CDD:275368 7/27 (26%)
zf-H2C2_2 162..185 CDD:290200 9/60 (15%)
C2H2 Zn finger 177..197 CDD:275368 7/27 (26%)
C2H2 Zn finger 205..225 CDD:275368 9/20 (45%)
zf-C2H2_8 206..286 CDD:292531 23/82 (28%)
C2H2 Zn finger 233..253 CDD:275368 5/19 (26%)
C2H2 Zn finger 260..297 CDD:275368 9/36 (25%)
C2H2 Zn finger 303..323 CDD:275368 7/19 (37%)
C2H2 Zn finger 353..373 CDD:275368 5/19 (26%)
CG3032NP_001284974.1 zf-AD 13..95 CDD:285071 12/45 (27%)
C2H2 Zn finger 158..179 CDD:275368 8/20 (40%)
C2H2 Zn finger 188..209 CDD:275368 6/20 (30%)
C2H2 Zn finger 218..239 CDD:275368 1/20 (5%)
C2H2 Zn finger 254..275 CDD:275368 7/20 (35%)
C2H2 Zn finger 294..315 CDD:275368 9/20 (45%)
C2H2 Zn finger 325..345 CDD:275368 5/19 (26%)
C2H2 Zn finger 352..373 CDD:275368 7/31 (23%)
C2H2 Zn finger 381..401 CDD:275368 7/19 (37%)
C2H2 Zn finger 409..429 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.