DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neu2 and zgc:174703

DIOPT Version :9

Sequence 1:NP_649316.1 Gene:Neu2 / 40375 FlyBaseID:FBgn0037085 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001191325.1 Gene:zgc:174703 / 100533191 ZFINID:ZDB-GENE-080208-4 Length:382 Species:Danio rerio


Alignment Length:352 Identity:116/352 - (32%)
Similarity:164/352 - (46%) Gaps:48/352 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 FLKDVREEESENDGSGCSEEVEAAERDLQDGADDVDSGNEPDINEC-----DIKAKEKP------ 117
            |:|    ||||:  ....|.....:.|||:..|.:....|...|:.     :|.|.|||      
Zfish     3 FIK----EESED--VKIEETFTVKQEDLQEQTDLMVLKEETQCNKMEEQHQEITADEKPTLTEKT 61

  Fly   118 -------------GFSCSHCPKSFQVKSNLKVHMRSHTGERPFTCSLCPKSFGYSSGLQNHMRTH 169
                         .||.....|||..|.||.||||.||.|:|:||..|.||||....|:.|||.|
Zfish    62 SSLGRPRKSKTECNFSSKQRRKSFIQKLNLGVHMRVHTREKPYTCEQCGKSFGKKRSLKTHMRIH 126

  Fly   170 TGERPFQCSHCPRSFTAGHHLKAHIQMHERRGSLRCPYCQKCFLTSLILKQHLATHTDETQFKCS 234
            |||||:.|..|.:||.....||.|:::|.......|..|.|.|..|..||.|:.:||.|..:.|.
Zfish   127 TGERPYTCQQCGKSFKQIGTLKGHMRIHTGERPYTCQQCGKSFKQSATLKGHMRSHTGERPYTCQ 191

  Fly   235 QCSKSFQVEHELWMHMRVHQ-ERLFTCGHCSKDF----ALHAYLKRHLSRNARC----SQSSKAS 290
            ||.:||........|.|:|. |:.:||..|.|.|    .|..:::.|.....:|    :|..|..
Zfish   192 QCGQSFYYAGNFAAHKRIHTGEKPYTCQQCGKSFKQSGTLKGHMRIHNGGKTQCGKSFAQKQKLD 256

  Fly   291 AHKTLGHS--KALKCGKCPKTFTDRSALSTHLKSHTKNKPLLEGPCKSSGSKPAH------SNAQ 347
            .|.|: |:  |...|.:|.|:||.:|:|..|:|:||:.|......|:.|.:..|:      .::.
Zfish   257 THMTI-HTEEKPYTCTECGKSFTCKSSLINHMKTHTREKLFTCNQCEKSFTCKANFMNHMDGHSG 320

  Fly   348 RKPFKCSSCPRTFSRKSALLTHLQTHT 374
            ...|.|..|.::.:||..:..|::||:
Zfish   321 NIVFICDQCGKSLTRKDYIKQHMKTHS 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Neu2NP_649316.1 zf-AD 1..63 CDD:285071
COG5048 <119..241 CDD:227381 56/121 (46%)
C2H2 Zn finger 121..141 CDD:275368 10/19 (53%)
zf-H2C2_2 133..158 CDD:290200 16/24 (67%)
C2H2 Zn finger 149..169 CDD:275368 10/19 (53%)
zf-H2C2_2 162..185 CDD:290200 13/22 (59%)
C2H2 Zn finger 177..197 CDD:275368 7/19 (37%)
C2H2 Zn finger 205..225 CDD:275368 8/19 (42%)
zf-C2H2_8 206..286 CDD:292531 27/88 (31%)
C2H2 Zn finger 233..253 CDD:275368 7/19 (37%)
C2H2 Zn finger 260..297 CDD:275368 11/44 (25%)
C2H2 Zn finger 303..323 CDD:275368 9/19 (47%)
C2H2 Zn finger 353..373 CDD:275368 5/19 (26%)
zgc:174703NP_001191325.1 zf-H2C2_2 90..113 CDD:290200 14/22 (64%)
C2H2 Zn finger 106..126 CDD:275368 10/19 (53%)
COG5048 <115..361 CDD:227381 75/234 (32%)
zf-H2C2_2 118..143 CDD:290200 14/24 (58%)
C2H2 Zn finger 134..154 CDD:275368 7/19 (37%)
zf-H2C2_2 147..171 CDD:290200 8/23 (35%)
C2H2 Zn finger 162..182 CDD:275368 8/19 (42%)
zf-H2C2_2 175..199 CDD:290200 11/23 (48%)
C2H2 Zn finger 190..210 CDD:275368 7/19 (37%)
zf-H2C2_2 202..227 CDD:290200 9/24 (38%)
C2H2 Zn finger 218..238 CDD:275368 5/19 (26%)
C2H2 Zn finger 243..262 CDD:275368 5/19 (26%)
zf-H2C2_2 255..279 CDD:290200 8/24 (33%)
C2H2 Zn finger 270..290 CDD:275368 9/19 (47%)
C2H2 Zn finger 298..315 CDD:275368 3/16 (19%)
C2H2 Zn finger 326..346 CDD:275368 5/19 (26%)
C2H2 Zn finger 354..374 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.