DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neu2 and LOC100332458

DIOPT Version :9

Sequence 1:NP_649316.1 Gene:Neu2 / 40375 FlyBaseID:FBgn0037085 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_002661836.5 Gene:LOC100332458 / 100332458 -ID:- Length:361 Species:Danio rerio


Alignment Length:399 Identity:127/399 - (31%)
Similarity:183/399 - (45%) Gaps:63/399 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASVFDESHEPGLSIAYIIYKCTGWQVEKHDPLSNTICKSCLEDAQNAFDIIETYERSHQFYRFL 65
            ||.:.:||.:..:...:.:         ||            ||.|...|::...|.:||.    
Zfish     1 MAFIKEESEDVKIEETFSV---------KH------------EDLQEQTDLMVLKEETHQL---- 40

  Fly    66 KDVREEESENDGSGCSEEVEAAERDLQDG-ADDVDSGNEPDINECDIKAKEKPGFSCSHCPKSFQ 129
             :|.||:.:      .|:.:....|.:.. .....|...|.      |:|....:||:.|.|||.
Zfish    41 -NVMEEKQQ------FEKHQVITTDEKPTLTKKTSSRGRPR------KSKSMCNYSCTRCRKSFS 92

  Fly   130 VKSNLKVHMRSHTGERPFTCSLCPKSFGYSSGLQNHMRTHTGERPFQCSHCPRSFTAGHHLKAHI 194
            .||||.:|||.||.|:|:||..|.|.|||..|.:||||.||||||:.|..|.:||....:..||.
Zfish    93 KKSNLDIHMRVHTKEKPYTCKQCGKRFGYIQGFENHMRIHTGERPYTCQQCGKSFYHAGNFAAHQ 157

  Fly   195 QMHERRGSLRCPYCQKCFLTSLILKQHLATHTDETQFKCSQCSKSFQVEHELWMHMRVH-QERLF 258
            ::|.......|.:|.|.|..:..|..|:..||.|..:.||||.|||:....|.:|||.| :||:|
Zfish   158 RIHTGERKYTCQHCGKSFSKTGNLAVHMRIHTGEKPYSCSQCGKSFKQNVTLKIHMRTHNEERIF 222

  Fly   259 TCGHCSKDFALHAYLKRHL-----SRNARCSQSSKASAHK-TLGH-------SKALKCGKCPKTF 310
            ||..|.|..:...||..|:     .:...|::..|:..:| :|.|       .|...|.:|.|:|
Zfish   223 TCTQCGKSISQKHYLDIHMRIHTGEKPYTCTECGKSFPYKGSLNHHMISHTGEKPFTCAQCGKSF 287

  Fly   311 TDRSALSTHLKSHTKNKPLLEGPCKSSGSK--------PAHSNAQRKPFKCSSCPRTFSRKSALL 367
            |.:::|..|:..||.........|..|.::        ..||...|  |:||.|.:.|..|.:|.
Zfish   288 TTKTSLMNHMDGHTGTIVFTCDQCGKSLTRKDSMKQHMKTHSGENR--FRCSECGKGFKCKRSLS 350

  Fly   368 THLQTHTGK 376
            |||:.|.|:
Zfish   351 THLKLHNGE 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Neu2NP_649316.1 zf-AD 1..63 CDD:285071 13/61 (21%)
COG5048 <119..241 CDD:227381 57/121 (47%)
C2H2 Zn finger 121..141 CDD:275368 12/19 (63%)
zf-H2C2_2 133..158 CDD:290200 14/24 (58%)
C2H2 Zn finger 149..169 CDD:275368 11/19 (58%)
zf-H2C2_2 162..185 CDD:290200 13/22 (59%)
C2H2 Zn finger 177..197 CDD:275368 6/19 (32%)
C2H2 Zn finger 205..225 CDD:275368 6/19 (32%)
zf-C2H2_8 206..286 CDD:292531 31/85 (36%)
C2H2 Zn finger 233..253 CDD:275368 11/19 (58%)
C2H2 Zn finger 260..297 CDD:275368 10/42 (24%)
C2H2 Zn finger 303..323 CDD:275368 7/19 (37%)
C2H2 Zn finger 353..373 CDD:275368 9/19 (47%)
LOC100332458XP_002661836.5 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.