DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neu2 and LOC100148466

DIOPT Version :9

Sequence 1:NP_649316.1 Gene:Neu2 / 40375 FlyBaseID:FBgn0037085 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001314792.1 Gene:LOC100148466 / 100148466 -ID:- Length:321 Species:Danio rerio


Alignment Length:340 Identity:110/340 - (32%)
Similarity:161/340 - (47%) Gaps:54/340 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 FLK----DVREEESENDGSGCSEEVEAAERDLQDGADDVDSGNEPDINECDIKAKEKPG------ 118
            |:|    ||:.||:.....|          |||:..|.::........|..:|.:||..      
Zfish     3 FIKVESEDVKIEETSTVKQG----------DLQEQTDLIEENEGSKEEEHHVKIEEKNNLQTDGF 57

  Fly   119 --------FSCSHCPKSFQVKSNLKVHMRSHTGERPFTCSLCPKSFGYSSGLQNHMRTHTGERPF 175
                    |:|:.|..||..|.:||:|.|.|||::||||:.|..||..||.|..|||.||||:||
Zfish    58 LKRRDKNHFTCTQCGTSFGRKRDLKIHRRIHTGKKPFTCTQCGNSFNSSSHLNQHMRIHTGEKPF 122

  Fly   176 QCSHCPRSFTAGHHLKAHIQMHERRGSLRCPYCQKCFLTSLILKQHLATHTDETQFKCSQCSKSF 240
            .|:.|.:||:...:|..|::::.|.....|..|.|.|..|..|.:|:..||.|..|.|:||..||
Zfish   123 TCTQCEKSFSQSSNLNLHMRIYTREKPFTCTQCGKNFNQSSNLNRHMRIHTGEKPFTCTQCGTSF 187

  Fly   241 QVEHELWMHMRVHQ-ERLFTCGHCSKDFALHAYLKRHLSRNARCSQSSKASAHKTLGHS--KALK 302
            .....|.:|:..|. |:.|||..|.:.|...::|.||:                 :.|:  |...
Zfish   188 IRSSSLNLHIMSHNGEKPFTCTQCGRSFNRSSHLNRHM-----------------MIHTGEKPFT 235

  Fly   303 CGKCPKTFTDRSALSTHLKSHTKNKPLLEGPCKSSGSKPAHSNAQ------RKPFKCSSCPRTFS 361
            |.:|..:|:..|.|:.|::.||..||.....|..|.|:.::.|..      .|||.|..|.::|:
Zfish   236 CTQCGMSFSQSSNLNLHMRIHTGEKPFACPQCGMSFSQSSNLNLHMRVHTGEKPFTCPQCGKSFN 300

  Fly   362 RKSALLTHLQTHTGK 376
            ..|.|..|::.|||:
Zfish   301 SSSHLNRHMRIHTGE 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Neu2NP_649316.1 zf-AD 1..63 CDD:285071
COG5048 <119..241 CDD:227381 54/121 (45%)
C2H2 Zn finger 121..141 CDD:275368 9/19 (47%)
zf-H2C2_2 133..158 CDD:290200 14/24 (58%)
C2H2 Zn finger 149..169 CDD:275368 10/19 (53%)
zf-H2C2_2 162..185 CDD:290200 13/22 (59%)
C2H2 Zn finger 177..197 CDD:275368 6/19 (32%)
C2H2 Zn finger 205..225 CDD:275368 7/19 (37%)
zf-C2H2_8 206..286 CDD:292531 27/80 (34%)
C2H2 Zn finger 233..253 CDD:275368 7/19 (37%)
C2H2 Zn finger 260..297 CDD:275368 6/36 (17%)
C2H2 Zn finger 303..323 CDD:275368 6/19 (32%)
C2H2 Zn finger 353..373 CDD:275368 6/19 (32%)
LOC100148466NP_001314792.1 C2H2 Zn finger 68..88 CDD:275368 9/19 (47%)
COG5048 <77..320 CDD:227381 90/256 (35%)
zf-H2C2_2 80..105 CDD:290200 14/24 (58%)
C2H2 Zn finger 96..116 CDD:275368 10/19 (53%)
zf-H2C2_2 108..133 CDD:290200 14/24 (58%)
C2H2 Zn finger 124..144 CDD:275368 6/19 (32%)
zf-C2H2 150..172 CDD:278523 7/21 (33%)
C2H2 Zn finger 152..172 CDD:275368 7/19 (37%)
zf-H2C2_2 164..189 CDD:290200 11/24 (46%)
C2H2 Zn finger 180..200 CDD:275368 7/19 (37%)
zf-C2H2 206..228 CDD:278523 8/38 (21%)
C2H2 Zn finger 208..228 CDD:275368 6/36 (17%)
zf-H2C2_2 220..245 CDD:290200 8/41 (20%)
C2H2 Zn finger 236..256 CDD:275368 6/19 (32%)
zf-H2C2_2 248..273 CDD:290200 8/24 (33%)
C2H2 Zn finger 264..284 CDD:275368 4/19 (21%)
zf-H2C2_2 276..301 CDD:290200 7/24 (29%)
C2H2 Zn finger 292..312 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000003
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.