DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and FOXQ1

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_150285.3 Gene:FOXQ1 / 94234 HGNCID:20951 Length:403 Species:Homo sapiens


Alignment Length:171 Identity:72/171 - (42%)
Similarity:102/171 - (59%) Gaps:24/171 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TRHYAQTAAGYGSASAVAAASSASAAAAAHYAYDQYSRYPYSASAYGLGA------------PHQ 64
            |:...:.:||.|..:..|..::|:||..|..|         .|.|.|.||            |:.
Human    60 TQGDGEQSAGGGPGAEEAIPAAAAAAVVAEGA---------EAGAAGPGAGGAGSGEGARSKPYT 115

  Fly    65 NKEIVKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFV 129
            .:.  ||||||||||||||:::|..::||..|.:|:|.:||::|.:..||:||:|||||||:|||
Human   116 RRP--KPPYSYIALIAMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFV 178

  Fly   130 KVARDDKKP-GKGSYWTLDPDSYNMFDNGSFLRRRRRFKKK 169
            ||.||..:| ||.:||.|:|:|...|.:|.|.|||:|...:
Human   179 KVLRDPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLSHR 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 50/86 (58%)
FOXQ1NP_150285.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..75 4/14 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..116 5/21 (24%)
FH 119..197 CDD:238016 46/77 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..266 0/4 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.