DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and FHL1

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_015429.1 Gene:FHL1 / 856219 SGDID:S000006308 Length:936 Species:Saccharomyces cerevisiae


Alignment Length:445 Identity:101/445 - (22%)
Similarity:175/445 - (39%) Gaps:106/445 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KPPYSYIALIAMAIQN-AADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVAR 133
            ||..||.|::...|:. :..|.::|:.||..|.|.||||:....|||:|:|||||||:.|.||: 
Yeast   461 KPTVSYSAMLTTCIRKYSTAKGMSLSEIYAGIRELFPYYKYCPDGWQSSVRHNLSLNKSFRKVS- 524

  Fly   134 DDKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKD-------------------------VMR 173
               |.|||..|.||.:         ::..|.|.|||.                         ..|
Yeast   525 ---KEGKGWLWGLDEE---------YIAERERQKKKQSEIAVAKAQAAQLKLEQQQHKLQQVPQR 577

  Fly   174 EKEEAIKRQAMMNEKLAEMKPLKLMTNGILEAKHMAA---HAAHFKKEPLM----DLGCLSGKEV 231
            .|::.:.:::.:|.:...:.............|:.|:   ....:.:|.|:    |...|| |:|
Yeast   578 GKKDIVSQRSNVNARKQNISQTLAANRAASNRKNTASDNQRTMKYLQEQLVILTRDRKGLS-KQV 641

  Fly   232 SHAAMLNSCHDSLAQMNHLAGGGVEHPGFTVDSLMNVYNPRIHHSAYPYHLN-----EDNLAT-- 289
            ..|.:..:...::.|:...|    ::.|.|.:.|..:.:..      |.|||     ..|.||  
Yeast   642 IAAILTQALAMTINQVTQAA----KNKGITGNPLTALMDKN------PQHLNLILAAAVNAATAK 696

  Fly   290 VASSQMHHVHH---------AAAAHHAQQLQRHVAHVAH-PLTPGGQGAGGQSS----------- 333
            |...::..:.:         ||.|.|::.:::.:....| |..|..|.:...||           
Yeast   697 VTKGEVKQLVNPETTAAAALAAKAQHSKPIRQPIVQTPHVPDRPPSQLSASASSHPNNYLHDKQP 761

  Fly   334 -GHSPTTISTPHGPAHGGWYTPETPPSEPVPHNGQQGTPTHP--------------GHNNNNSSS 383
             ...|:::|....|......|.....:. ||....|.....|              |.::::|||
Yeast   762 GSFDPSSLSRFFQPRQNARATSSVAATS-VPAAASQNVDAQPKPKPAQDNDLESESGTSSSSSSS 825

  Fly   384 VLNHNGVGNGGG---GGGGGGGGSSSVLTSSPTSALGFRDMIFEQNQSCQLDTGS 435
              :.:|..:..|   |...|.|.:||..:.|.:.:....::..:.|::.::|:.|
Yeast   826 --SESGSESDSGSDDGSASGSGDNSSTSSESESESDSGSEVDEKNNKNEKIDSES 878

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 37/86 (43%)
FHL1NP_015429.1 COG5025 18..739 CDD:227358 74/301 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.