DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and FKH2

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_014331.3 Gene:FKH2 / 855656 SGDID:S000005012 Length:862 Species:Saccharomyces cerevisiae


Alignment Length:459 Identity:109/459 - (23%)
Similarity:168/459 - (36%) Gaps:103/459 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QTAAGYGSASAVAAASSASAAAAAHYAYDQYSRYPYSASAYGLGAPHQNKEIVKPPYSYIALIAM 81
            |.|:..|..:.:.||:...       :|...:.|| .|..:.....|.....||||:||..:|..
Yeast   295 QAASPQGPPNTIIAANFVD-------SYKSSNAYP-QALDFTSDLSHDENRNVKPPHSYATMITQ 351

  Fly    82 AIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARDDKKPGKGSYWTL 146
            ||.::.:..::|..||:||...:.|||..|.|||||||||||||:.|.||.|...:||||..|.:
Yeast   352 AILSSPEGVISLADIYKYISSNYAYYRFAKSGWQNSIRHNLSLNKAFEKVPRRPNEPGKGMKWRI 416

  Fly   147 DPDSYNMFDNGSFLRRRRRFKKKDVMREKEEAIKRQAMMNEKLAEMKPLKLMTNGILEAKHMAAH 211
            . :||..    .||.:....|...:.|                           |...|:.:..|
Yeast   417 S-ESYQQ----EFLNKWNTGKVGKIRR---------------------------GSSVARQLQLH 449

  Fly   212 AAHFKKEPLMDLGCLSGKEVSHAAMLNSCHDSLAQM----------NHLAGGGVEHPGFTVDSLM 266
            .|.|...|:         |:.:...||.......|:          |::..|.|:|    |.|..
Yeast   450 MAKFNSLPM---------EMDYRLSLNMAQPPKRQLQSHNVLEPSNNNIIEGFVQH----VPSKG 501

  Fly   267 NVYNPRIHHSAYPYHLNEDNLATVASSQMHHVHHAAAAHHAQQLQRHVAHVAHPL-TPGGQGAGG 330
            |:  |....|..|......:.......|...:...    .|....|::| :|.|: ||..| |..
Yeast   502 NL--PASQQSQPPVSHQNQSQQPPPQEQRQEIQFT----FADTQNRNIA-LARPIKTPQLQ-APN 558

  Fly   331 QSSGHSPTTISTPHGPAHGGWYTPETPPSEPVPHNGQQGTPTHPGHNNNNSSSVLNH-------N 388
            .::..:...:.......|        ||:..:....:|..       ||...|..|.       |
Yeast   559 SNANLNQNNMKEYKESLH--------PPAISISQMNRQSP-------NNALVSFTNACANSKIIN 608

  Fly   389 GVGNGGGGGGGGGGGSSSVLTSSPTSALGFRDMIFEQNQSCQLDTGSPTGSLQSASPPASASVAA 453
            .:.:.........||:...|.:..||:|         :::..|:..:.|.|..|.|.|.:.:..:
Yeast   609 NISDSADKSTNNNGGTKMNLPAISTSSL---------DENGNLEPTTTTSSGNSNSVPQTGTTTS 664

  Fly   454 ASAA 457
            :.||
Yeast   665 SLAA 668

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 41/85 (48%)
FKH2NP_014331.3 COG5025 1..610 CDD:227358 95/390 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 97 1.000 Domainoid score I1615
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.