DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and FKH1

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_012135.1 Gene:FKH1 / 854675 SGDID:S000001393 Length:484 Species:Saccharomyces cerevisiae


Alignment Length:100 Identity:37/100 - (37%)
Similarity:59/100 - (59%) Gaps:4/100 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 VKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVAR 133
            :|||.||.::|..||.:..:..::|..||::|.:.:.:||.::..||||:|||||||:.|.||.:
Yeast   302 IKPPQSYASMITQAILSTPEGSISLADIYKFISDNYAFYRFSQMAWQNSVRHNLSLNKAFEKVPK 366

  Fly   134 DDKKPGKGSYWTLDP----DSYNMFDNGSFLRRRR 164
            ...:.|||..|.:..    |..|.::.|...:.||
Yeast   367 RAGQQGKGMNWKISDEVRRDFLNKWNAGKLSKIRR 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 34/89 (38%)
FKH1NP_012135.1 COG5025 1..484 CDD:227358 36/99 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 97 1.000 Domainoid score I1615
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.