DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and HCM1

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_009991.2 Gene:HCM1 / 850429 SGDID:S000000661 Length:564 Species:Saccharomyces cerevisiae


Alignment Length:509 Identity:113/509 - (22%)
Similarity:185/509 - (36%) Gaps:144/509 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 NKEIV-KPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECF 128
            |.|:. ||||||..||.:||..:.:.|:||:.||.:|...||||:.....||||||||||||:.|
Yeast   103 NGELAKKPPYSYATLICLAILQSQEGKLTLSQIYHWIHVHFPYYKQKDASWQNSIRHNLSLNDAF 167

  Fly   129 VKVARDDKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVM--------------------- 172
            :|.  :....|||.:|.:.|.:...|..|.  .|...|.|..:.                     
Yeast   168 IKT--EKSCDGKGHFWEVRPGAETKFFKGE--NRGYEFVKDSLQDIGKYFEIDSTLDELEQVESG 228

  Fly   173 ---------REKEEAIKRQAMMNEKLAEMKPLKLMTNGILEAKHMAAHAAHFKKEPLMDLGCLSG 228
                     .|:|||.|..::         .::|.::.||....: .|....|.:          
Yeast   229 EGNDDLPDEEEREEAGKFPSI---------EIQLNSSPILRVSQL-HHIPQLKTD---------- 273

  Fly   229 KEVSHAAMLNSCHDSLAQMNHLAGGGVEHPGFTVDSLMNVYNPRIHHSA--YPYHLN-EDNL-AT 289
                 .::||. |::|..|.::    :|:....:|||...|..:.:|::  .|..:| :|:. |.
Yeast   274 -----NSVLNP-HENLESMRNM----IENDVNNIDSLEPPYVMKKYHTSLGLPSLVNAKDHFQAG 328

  Fly   290 VASSQMHHVHH-----AAAAHHAQQLQRHVAHV---AHPLTP--GGQGAGG--QSSGHSP----- 337
            |.::.:...:.     ..:|...|..:::....   ...|:|  ...|||.  ....:||     
Yeast   329 VKNNNITQANRFNTLPITSAKSPQNFRKYFTSFNSNFEDLSPLRSNVGAGSLLDPLPYSPLKLYD 393

  Fly   338 ----TTISTPHGPAHGGWYTPETPPSEPVPHNGQ-QGTP--THPGHNNNNSSSVLNHNGVGNGGG 395
                ..:|.|.....   |:....|..|..|... ..||  .|........|.:::....||   
Yeast   394 QKNLALMSKPQSQQS---YSNSQLPPPPSSHGSDLLKTPKMRHSDGLEKTPSRLISTPKDGN--- 452

  Fly   396 GGGGGGGGSSSVLTSSPTSALGFRDM----IFEQNQSCQLDTGSPTGSLQSASPPASASVAAASA 456
                      |:|....|.:..|.|:    :|...::......:|.|:|::...|..:|......
Yeast   453 ----------SILRKWQTPSHLFEDLYCSPLFRAIETPIRYITTPGGTLETQISPRKSSAPDVLT 507

  Fly   457 AAAAAVISS-------------------------------HHHHHHHHAALSGN 479
            :|..:..:|                               ||.:|:|.:..|||
Yeast   508 SATNSKFASSGLFGVDVYSVWKRATEKISDGNNTTDSNQKHHPYHNHPSNDSGN 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 40/85 (47%)
HCM1NP_009991.2 COG5025 20..564 CDD:227358 113/509 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.