DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and foxb1b

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_571358.2 Gene:foxb1b / 799571 ZFINID:ZDB-GENE-990415-77 Length:296 Species:Danio rerio


Alignment Length:371 Identity:111/371 - (29%)
Similarity:156/371 - (42%) Gaps:122/371 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARD 134
            |||||||:|.|||||:..:|.:.|:.||::||:||||||:|.|.||||:|||||.|:||:|:.|.
Zfish    13 KPPYSYISLTAMAIQSCPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPRR 77

  Fly   135 DKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVMREKEEAIKRQAMMNEKLAEMKPLKLMT 199
            ..:|||||:|.|.|...:||:||||||||:|||   ||...|..             .||     
Zfish    78 PDQPGKGSFWALHPSCGDMFENGSFLRRRKRFK---VMISSEHL-------------QKP----- 121

  Fly   200 NGILEAKHMAAHAAHFKKEP----LMDLGCLSGKEVSHAAMLNSCHDSLAQMNHLAGGGVEHPGF 260
                      :.|||:.::.    :..||       :|...:.|.:.|:.|.:..     :|| |
Zfish   122 ----------SDAAHYLQQQAKLRMTALG-------THLPQMTSYNLSVTQPSTF-----KHP-F 163

  Fly   261 TVDSLMNVYNPRIHHSAYPYHLNEDNLATVASSQMHHVHHAAAAHH-----------AQQLQRHV 314
            .:::::          |..|.:.    .::|.|.||.:......|:           :..:....
Zfish   164 AIENII----------ARDYKMP----GSLAFSAMHSMSTGYQIHNQLTTAWPHMYSSNVIDAEY 214

  Fly   315 AHVAHPLTPGGQGAGGQSSGHSPTTISTPHGPAHGGWYTPETPPSEPVPH---------NGQQGT 370
            |....||.....||      .|...|..|..||      |.:.||.|..|         :.|..:
Zfish   215 AAYGVPLKSLSHGA------QSLPAIPVPIKPA------PASVPSIPALHAHLPAFLSGSPQSLS 267

  Fly   371 PTHPGHNNNNSSSVLNHNGVGNGGGGGGGGGGGSSSVLTSSPTSAL 416
            |..|..:|                            ..|.||||.|
Zfish   268 PASPSQSN----------------------------PATPSPTSLL 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 51/85 (60%)
foxb1bNP_571358.2 FH 13..101 CDD:214627 52/87 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.