DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and foxk2b

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:XP_001922856.1 Gene:foxk2b / 798356 ZFINID:ZDB-GENE-030131-5310 Length:597 Species:Danio rerio


Alignment Length:467 Identity:118/467 - (25%)
Similarity:167/467 - (35%) Gaps:173/467 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 KEIVKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVK 130
            |:..||||||..||..||..|.||::||||||.:|.:.:||||...:|||||||||||||..|:|
Zfish   207 KDDSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIK 271

  Fly   131 VARDDKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVMREKEEAIKRQAMMNEKLAEMKPL 195
            |.|..::|||||:|.:||.|.......:|.:||.|                              
Zfish   272 VPRSQEEPGKGSFWRIDPSSEGKLVEQAFRKRRPR------------------------------ 306

  Fly   196 KLMTNGILEAKHMAAHAAHFKKEPLM--DLGCLSGKEV----SHAAMLNSCHDSLAQMNHLAGGG 254
                 |:                |..  .||.||.:..    :|:.:| |.|.|          |
Zfish   307 -----GV----------------PCFRTPLGPLSSRSAPASPNHSGVL-SAHSS----------G 339

  Fly   255 VEHPGFTVDSLMNVYNPRIHHSAYPYHLNEDNLATVASSQ------------------------- 294
            |:.|    |||....:| :...:.|..:.......||:.|                         
Zfish   340 VQTP----DSLSREGSP-VPMESEPVSVPPPAAVAVAAVQPKLAVIQETRFTQNTTASPITTQPV 399

  Fly   295 -----------MHHVHHAAAA-----HHAQQLQRHVAHVAHPLTPGGQGAGGQSSGHSPTTISTP 343
                       |..|.:|.||     ..||.|.:.| ||.|           |....:.:|:.|.
Zfish   400 LIAVQRPLTQNMKPVTYAVAAPVSSSTSAQPLMQTV-HVVH-----------QIPAVAVSTVKTE 452

  Fly   344 HGPAHGGWYTPETPPSEPVPHNGQQGTPTHPGHNNNNSSSVLNHNGVGNGGGGGGGGGGGSSSVL 408
              |...|.|.......|.||                         |:.:     |..|..:..:.
Zfish   453 --PRENGDYDELKVKVEAVP-------------------------GIAH-----GSIGTANRVIQ 485

  Fly   409 TSSPTSALGFRDMIFEQNQSCQLDTGSPTGS----LQSASPPASASVAAASAAAAAA-VISSHHH 468
            ||:..:.|          |:..:...:|.|.    :::.:...:..|..|:|..:.| .:||..|
Zfish   486 TSAAATPL----------QTVTIVQQAPLGQHQLPIKTITQNGTHVVPIATAIQSQANTVSSPLH 540

  Fly   469 HHHHHAALSGNL 480
            ....||:.|.:|
Zfish   541 LLAAHASASASL 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 50/85 (59%)
foxk2bXP_001922856.1 FHA 17..109 CDD:238017
Forkhead 211..297 CDD:278670 50/85 (59%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.