DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and foxl2a

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001038717.1 Gene:foxl2a / 692279 ZFINID:ZDB-GENE-060512-241 Length:306 Species:Danio rerio


Alignment Length:289 Identity:104/289 - (35%)
Similarity:144/289 - (49%) Gaps:45/289 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 PHQNKEIVKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNE 126
            |.::....||||||:|||||||:.:::|::||:||||||:.:||:|..||:||||||||||||||
Zfish    38 PDKSDPTQKPPYSYVALIAMAIRESSEKRLTLSGIYQYIISKFPFYEKNKKGWQNSIRHNLSLNE 102

  Fly   127 CFVKVARDDKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVMREKEEAIKRQAMMNEKLAE 191
            ||:||.|:.....||:||||||...:||:.|:: |||||.|:............:.....|....
Zfish   103 CFIKVPREGGGERKGNYWTLDPACEDMFEKGNY-RRRRRMKRPFRPPPTHFQPGKSLFGGEGYGY 166

  Fly   192 MKPLKLMTNGILEAKHMAAHAAHFKKEPLMDLGCLSGKEVSHAAMLNSCHDSLAQMNHLAGGGVE 256
            :.|.|.:.:|.:......|        |:....|    :||..::      |...|..|:.....
Zfish   167 LSPPKYLQSGFINNSWSPA--------PMSYTSC----QVSSGSV------SPVNMKGLSAPSSY 213

  Fly   257 HP-----GFTVDSLMNVYNPRIHHSAYPYHLNEDNLATVASSQMHHVHHAAAAHHAQQLQRHVAH 316
            :|     ...:.|::|.||...||    :|              ||..|..|..|||||....| 
Zfish   214 NPYSRVQSIGLPSMVNSYNGISHH----HH--------------HHHTHPHALPHAQQLSPATA- 259

  Fly   317 VAHPLTPGGQGAGGQ-SSGHSPTTISTPH 344
            .|.|:|. |.|.|.| :....|..:|..|
Zfish   260 AAPPVTT-GNGTGLQFACSRQPAELSMMH 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 56/85 (66%)
foxl2aNP_001038717.1 Forkhead 46..131 CDD:306709 55/84 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.