DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and Foxb2

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001162056.1 Gene:Foxb2 / 691398 RGDID:1585019 Length:425 Species:Rattus norvegicus


Alignment Length:465 Identity:130/465 - (27%)
Similarity:164/465 - (35%) Gaps:200/465 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARD 134
            |||||||:|.|||||::|:|.:.|:.||::|||||||||::.|.||||:|||||.|:||:|:.|.
  Rat    13 KPPYSYISLTAMAIQHSAEKMLPLSDIYKFIMERFPYYREHTQRWQNSLRHNLSFNDCFIKIPRR 77

  Fly   135 DKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVMREKEEAIKRQAMMNEKLAEMKPLKLMT 199
            ..:|||||:|.|.||..:||:||||||||:|||                                
  Rat    78 PDQPGKGSFWALHPDCGDMFENGSFLRRRKRFK-------------------------------- 110

  Fly   200 NGILEAKHMAAHAAHFKKEPLMDLGCLSGKEVSHAAMLNSCHDSLAQMNHLAGGGVEHPGFTVDS 264
              :|.|.|...|:...|..|                             ....||..||      
  Rat   111 --VLRADHAHLHSGSSKGAP-----------------------------GTGPGGHLHP------ 138

  Fly   265 LMNVYNPRIHHSAYPYHLNEDNLATVASSQMHHVHHAAAAHHAQQLQRHVAHVAHPLTPGGQGAG 329
                     ||..:.:|              ||.||..||||      |  |..||..|      
  Rat   139 ---------HHPHHAHH--------------HHHHHHHAAHH------H--HHHHPPQP------ 166

  Fly   330 GQSSGHSPTTISTPHGPAHGGWY-------TPETP--PSEPV---PHNGQQGTPTHPGHNNNNSS 382
                         |..|.|...|       .|:.|  ||:|.   |...|....:|||.....::
  Rat   167 -------------PPPPPHMVPYFHQQPAPAPQPPHLPSQPAQQPPPQSQPPQTSHPGKMQEAAA 218

  Fly   383 SVLNHNGVGNGGGGGGGGGGGSSSVLTSSPTSALGFRDMIFEQNQSCQLDTGSPTGSLQSASPPA 447
                   |............||...|:..|...||                              
  Rat   219 -------VAAAAAAAAAAAVGSVGRLSQFPPYGLG------------------------------ 246

  Fly   448 SASVAAASAAAAAAVISSHHHH-------------------------HHHHAALSGNLGQLGQLS 487
              |.|||:|||||:.....|..                         ||....:.|.||.:    
  Rat   247 --SAAAAAAAAAASTTGFKHPFAIENIIGRDYKGVLQAGGLPLASVMHHLGYPVPGQLGNV---- 305

  Fly   488 NLSHYRPHVG 497
             :....||||
  Rat   306 -VGSVWPHVG 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 53/85 (62%)
Foxb2NP_001162056.1 FH 13..101 CDD:214627 54/87 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.