DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and Foxf1

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:XP_006255786.2 Gene:Foxf1 / 687536 RGDID:1584229 Length:447 Species:Rattus norvegicus


Alignment Length:437 Identity:126/437 - (28%)
Similarity:176/437 - (40%) Gaps:113/437 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AQTAAGYGSASAVAAAS-----------SASAAAAAHYAYDQYSRYPYSASAYGLGAPHQNKEIV 69
            ||::.|.|..|:...::           :.....|...|.|..:..|..|.....|.    :...
  Rat    56 AQSSGGSGGGSSHPMSAPDKQQPPHGGGTGGGGGAGGQAMDPAAAGPTKAKKTNAGV----RRPE 116

  Fly    70 KPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARD 134
            ||||||||||.||||::..|::||:.|||::..|||::|...|||:||:||||||||||:|:.:.
  Rat   117 KPPYSYIALIVMAIQSSPSKRLTLSEIYQFLQARFPFFRGAYQGWKNSVRHNLSLNECFIKLPKG 181

  Fly   135 DKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVMREKEEAIKRQAMMNEKLAEMKPLKLMT 199
            ..:||||.|||:||.|..||:.|||.||.|.|::                   |...:||:..|.
  Rat   182 LGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRR-------------------KCQALKPVYSMV 227

  Fly   200 NGILEAKHMAAHAAHFKKEPLMDLGCLSGKEVSHAAMLNSCHDSLAQMN-HLAGGGVEHPGFTVD 263
            || |...|:..           ..|......:|.|....:....|..|| ||.|        .||
  Rat   228 NG-LGFNHLPD-----------TYGFQGSGGLSCAPNSLALEGGLGMMNGHLTG--------NVD 272

  Fly   264 SLMNVYNPRIHHSAYPYHLNEDNLATVASSQMHHVHHAAAAHHAQQLQRHVAHV-AHPLTPGGQG 327
            .:           |.|.|    ::..:.|:..|..........|.:...|.:.| |.||.|.  |
  Rat   273 GM-----------ALPSH----SVPHLPSNGGHSYMGGCGGSAAGEYPHHDSSVPASPLLPA--G 320

  Fly   328 AGGQSSGHSPTTISTPHGPA-------HGGWY------TPETPPSEPV----------------- 362
            |||....|:..:.|....|.       .|..|      :|..|.:.|:                 
  Rat   321 AGGVMEPHAVYSSSAAAWPPAASAALNSGASYIKQQPLSPCNPAANPLSGSISTHSLDQPYLHQN 385

  Fly   363 PHNGQ---QGTPTHPGHNNNNS-----SSVLNHNGVGNGGGGGGGGG 401
            .|||.   ||.|.:  |:.:.|     ..|.:.|.:.:......|||
  Rat   386 SHNGPAELQGIPRY--HSQSPSMCDRKEFVFSFNAMASSSMHTTGGG 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 52/85 (61%)
Foxf1XP_006255786.2 FH_FOXF1 118..216 CDD:410823 58/116 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.