DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and FOXL2

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_075555.1 Gene:FOXL2 / 668 HGNCID:1092 Length:376 Species:Homo sapiens


Alignment Length:423 Identity:126/423 - (29%)
Similarity:172/423 - (40%) Gaps:136/423 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 APHQNKEIVKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLN 125
            ||.:.....||||||:|||||||:.:|:|::||:||||||:.:||:|..||:|||||||||||||
Human    45 APEKPDPAQKPPYSYVALIAMAIRESAEKRLTLSGIYQYIIAKFPFYEKNKKGWQNSIRHNLSLN 109

  Fly   126 ECFVKVARDDKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVMREKEEAIKRQAMMNEKLA 190
            |||:||.|:.....||:||||||...:||:.|:: |||||.|                       
Human   110 ECFIKVPREGGGERKGNYWTLDPACEDMFEKGNY-RRRRRMK----------------------- 150

  Fly   191 EMKPLKLMTNGILEAKHMAAHAAHFKK-EPLMDLGCLSGKEVSHAAMLNSCHDSLAQMNHLAGGG 254
              :|.:             ...|||:. :.|...|..:|          .|        .:||.|
Human   151 --RPFR-------------PPPAHFQPGKGLFGAGGAAG----------GC--------GVAGAG 182

  Fly   255 VEHPGFTVDSLMNVYNPRIHHSAY--------------PYHLNEDNLATVASSQMHHVHHAAAAH 305
            .:..|:...       |:...|.:              ||          ||.||.....|||| 
Human   183 ADGYGYLAP-------PKYLQSGFLNNSWPLPQPPSPMPY----------ASCQMAAAAAAAAA- 229

  Fly   306 HAQQLQRHVAHVAHPLTPGG----QGAGGQSSGHSPTT----ISTPHGPAH-----GGWYTPETP 357
                    .|..|.|.:||.    :|..|.::.:.|.|    ::.|.|..:     ||  .|..|
Human   230 --------AAAAAGPGSPGAAAVVKGLAGPAASYGPYTRVQSMALPPGVVNSYNGLGG--PPAAP 284

  Fly   358 PSEPVPH--------NGQQGTPTHPGHNNNNSSSVLNHNGVGNGGGGGGGGGGGSSSVLTSSPTS 414
            |..|.||        :.....|..|.|          |.......|........:::....:|||
Human   285 PPPPHPHPHPHAHHLHAAAAPPPAPPH----------HGAAAPPPGQLSPASPATAAPPAPAPTS 339

  Fly   415 ALGFRDMIFEQNQSCQL-----DTGSPTGSLQS 442
            |.|.:.....|.:...:     |..|.||:|.|
Human   340 APGLQFACARQPELAMMHCSYWDHDSKTGALHS 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 57/85 (67%)
FOXL2NP_075555.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53 2/7 (29%)
Forkhead 53..139 CDD:365978 56/85 (66%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 276..342 17/77 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.