DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and Foxq1

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_074049.2 Gene:Foxq1 / 64826 RGDID:621572 Length:400 Species:Rattus norvegicus


Alignment Length:177 Identity:71/177 - (40%)
Similarity:100/177 - (56%) Gaps:17/177 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AAGYGSASAVAAASSASAAAAAHYAYD---------QYSRYPYSASAYGLGAPHQNKEIV---KP 71
            |||.|:..........:::..|....|         |.|.....|.:.|.|...::|...   ||
  Rat    52 AAGRGAVDLEGGGGERNSSGGASTQDDPEVTDGSRTQASPVGPCAGSVGGGEGARSKPYTRRPKP 116

  Fly    72 PYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARDDK 136
            ||||||||||||:::|..::||..|.:|:|.:||::|.:..||:||:|||||||:|||||.||..
  Rat   117 PYSYIALIAMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPS 181

  Fly   137 KP-GKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVMR----EKEEA 178
            :| ||.:||.|:|:|...|.:|.|.|||:|...:..:.    ..|||
  Rat   182 RPWGKDNYWMLNPNSEYTFADGVFRRRRKRLSHRTTVSASGLRPEEA 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 50/86 (58%)
Foxq1NP_074049.2 FH 115..193 CDD:238016 46/77 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.