DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and Foxb1

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_071773.2 Gene:Foxb1 / 64290 MGIID:1927549 Length:325 Species:Mus musculus


Alignment Length:436 Identity:124/436 - (28%)
Similarity:175/436 - (40%) Gaps:162/436 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARD 134
            |||||||:|.|||||::.:|.:.|:.||::||:||||||:|.|.||||:|||||.|:||:|:.|.
Mouse    13 KPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPRR 77

  Fly   135 DKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVMREKEEAIKRQAMMNEKLAEMKPLK--- 196
            ..:|||||:|.|.|...:||:||||||||:|||               .:.::.||..||..   
Mouse    78 PDQPGKGSFWALHPSCGDMFENGSFLRRRKRFK---------------VLKSDHLAPSKPADAAQ 127

  Fly   197 -LMTNGILEAKHMAAHAAHFKKEPLMDLGCLSGKEVSHAAMLNSCHDSLAQMNHLAG----GGVE 256
             |.....|....:||...|..:.|              ||..|           |.|    .|.:
Mouse   128 YLQQQAKLRLSALAASGTHLPQMP--------------AAAYN-----------LGGVAQPSGFK 167

  Fly   257 HPGFTVDSLM------------NVYNPRIHHSAYPYHLNEDNLATVASS---QMHHVHHAAAAHH 306
            || |.:::::            :...|  ..:|||.   .:.|.|:.||   ...||:.:|.   
Mouse   168 HP-FAIENIIAREYKMPGGLAFSAMQP--VPAAYPL---PNQLTTMGSSLGTGWPHVYGSAG--- 223

  Fly   307 AQQLQRHVAHVAHP--LTPGGQGAGG-------QSSGHSPTTISTPHGPAHGGWYTPETPPS--- 359
                   :...|.|  :|.|...|.|       .::|.:...|..|..|      ||...|:   
Mouse   224 -------MIDSATPISMTSGDYSAYGVPLKPLCHAAGQTLPAIPVPIKP------TPAAVPALPA 275

  Fly   360 --EPVPHNGQQGTPTHPGHNNNNSSSVLNHNGVGNGGGGGGGGGGGSSSVLTSSPTSALGFRDMI 422
              .|:|                                          ::|::||.|.       
Mouse   276 LPAPIP------------------------------------------TLLSNSPPSL------- 291

  Fly   423 FEQNQSCQLDTGSPTGS--LQSASPPASASVAAASAAAAAAVISSH 466
                        |||.|  ..|.|.||:.|....|.|:|...::.|
Mouse   292 ------------SPTSSQTATSQSSPATPSETLTSPASALHSVAVH 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 51/85 (60%)
Foxb1NP_071773.2 FH 13..101 CDD:214627 52/87 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 284..325 16/59 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.