DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and Foxj2

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_068699.1 Gene:Foxj2 / 60611 MGIID:1926805 Length:565 Species:Mus musculus


Alignment Length:425 Identity:113/425 - (26%)
Similarity:173/425 - (40%) Gaps:116/425 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VAAASSASAAAAAHYAYDQYSRYPYSASAYGLGAPHQNKEIVKPPYSYIALIAMAIQNAADKKVT 92
            :.:||.|.....|..........|.:..:....|.||:.   ||.|||..||..||.::..||:|
Mouse    27 LGSASQAGPPGGARKCSPGSPTDPNATLSKDEAAVHQDG---KPRYSYATLITYAINSSPAKKMT 88

  Fly    93 LNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARDDKKPGKGSYWTLD--PDSYNMFD 155
            |:.||::|.:.||||::...||:||||||||||:||.||.|....||||||||:|  ||      
Mouse    89 LSEIYRWICDNFPYYKNAGIGWKNSIRHNLSLNKCFRKVPRPRDDPGKGSYWTIDTCPD------ 147

  Fly   156 NGSFLRRRRRFKKKDVMRE---KEEAIK----------RQAMMNEKLAEMKPLKLMTNGILEAKH 207
                :.|:||....|.:.:   ::||.|          ..::.:|...:|            :..
Mouse   148 ----ISRKRRHPPDDDLSQDSPEQEASKSPRGGVPGSGEASLSHEGTPQM------------SLQ 196

  Fly   208 MAAHAAHFKKEP-LMDLGCLS----GKEVSHAA--MLNSCHD---SLAQMN--HLAGGGVEHPGF 260
            ..:..|::.:.| .:|.|.::    |:|.:..|  :.|:.||   |.:::|  .|:.        
Mouse   197 SPSSVANYSQGPGSVDGGAVAAGAPGQESTEGAPPLYNTNHDFKFSYSEINFQDLSW-------- 253

  Fly   261 TVDSLMNVYNPRIHHSAYPYHLNEDNLATVASSQMHHVHHAAAAHHAQQLQRH------------ 313
               |..|:|...:..|:...|.....|..:..|..::|:.       ||.|:.            
Mouse   254 ---SFRNLYKSMLERSSSSQHGFSSLLGDMPPSNNYYVYQ-------QQQQQQPPPQPQPPPQQP 308

  Fly   314 -------------------VAHVAHP---LTPGGQGAGGQSSGHSPTTISTPHGP--AHGGWYTP 354
                               ..|...|   .||||:.||.:  |:.|.|....|.|  .|||::  
Mouse   309 QPQQQQAPTQGPSNVGGAPPLHTPSPDGCTTPGGKQAGAE--GYGPPTGMAMHPPPLQHGGYH-- 369

  Fly   355 ETPPSEPVPHNGQQGTPTHPGHNNNNSSSVLNHNG 389
               |.:..||:.....|..|   ...|.:.:|..|
Mouse   370 ---PHQHHPHSHPAQQPPQP---QAQSQASINSTG 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 48/87 (55%)
Foxj2NP_068699.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 29..61 5/31 (16%)
Forkhead 66..143 CDD:278670 45/76 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 125..233 30/129 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 290..399 27/126 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 543..565
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.