DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and foxh1

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_571577.1 Gene:foxh1 / 57930 ZFINID:ZDB-GENE-000616-15 Length:472 Species:Danio rerio


Alignment Length:137 Identity:50/137 - (36%)
Similarity:78/137 - (56%) Gaps:35/137 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 YSRYPYSASAYGLGAPHQNKEIVKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNK 111
            |.|||                  ||||||:|:|||.|||:.:||:||:.|.:.|...||:::.|.
Zfish    92 YQRYP------------------KPPYSYLAMIAMVIQNSPEKKLTLSEILKEISTLFPFFKGNY 138

  Fly   112 QGWQNSIRHNLSLNECFVKVARDDKKP-GKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVMREK 175
            :||::|:|||||..:|||||.:|..|| |||::||::.:...:                ::::.:
Zfish   139 KGWRDSVRHNLSSYDCFVKVLKDPGKPQGKGNFWTVEVNRIPL----------------ELLKRQ 187

  Fly   176 EEAIKRQ 182
            ..|:.||
Zfish   188 NTAVSRQ 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 43/86 (50%)
foxh1NP_571577.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..56
FH 97..174 CDD:238016 42/76 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 211..246
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 261..360
SMAD-interaction domain (SID) 339..465
Fast/FoxH1 motif 1 (FM1) 357..361
Fast/FoxH1 motif 2 (FM2) 367..373
SMAD interaction motif (SIM) 428..448
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.