DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and foxe3

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001073150.2 Gene:foxe3 / 570855 ZFINID:ZDB-GENE-061214-6 Length:422 Species:Danio rerio


Alignment Length:356 Identity:113/356 - (31%)
Similarity:159/356 - (44%) Gaps:119/356 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARD 134
            ||||||||||||||.|:.::|:||.|||::||||||:||:|.:.|||||||||:||:||||:.|:
Zfish   103 KPPYSYIALIAMAIANSPERKLTLGGIYKFIMERFPFYRENSKKWQNSIRHNLTLNDCFVKIPRE 167

  Fly   135 DKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVMREKEEAIKRQAMMNEKLAEMKPLKLMT 199
            ..:||||:||||||.:.:|||||||||||:|||:.||....                        
Zfish   168 PGRPGKGNYWTLDPAAEDMFDNGSFLRRRKRFKRTDVSTYP------------------------ 208

  Fly   200 NGILEAKHMAAHAAHFKKEPLMDLGCLSGKEVSHAAMLNSCHDSLAQMNHLAGGGVEHPGFTVDS 264
             |.:::      ::.|...|:       |::              |..|.|      :||.|   
Zfish   209 -GYMQS------SSAFTPTPM-------GRQ--------------AYPNTL------YPGVT--- 236

  Fly   265 LMNVYNPRIHHSAYPYHLNEDNLATVASSQMHHVHHAAAAHHAQQLQRHVAHVAHPLT---PGGQ 326
              :.|..::..|.:|             :.:||...:|.....|.....:.::....|   .||.
Zfish   237 --SGYGSQLAGSPHP-------------AMLHHYQASAGVTQGQARMFSIDNIISQQTVMQSGGD 286

  Fly   327 --------GAGGQSSGHSPTTISTPHGPAHGGWYTPETPPSEPVPHNGQQGTPTHPGHNNNNSSS 383
                    |||...:..|..::||                |:|.....|...||         |:
Zfish   287 LNTQSLGLGAGDLGTMTSSCSVST----------------SDPTCFQTQAINPT---------SN 326

  Fly   384 VLNHNGVGNGGGGGGGGGGGSSSVLTSSPTS 414
            :|:.|       .|......:||....||||
Zfish   327 MLSRN-------TGSLASNMTSSYTYPSPTS 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 58/85 (68%)
foxe3NP_001073150.2 FH 103..191 CDD:214627 60/87 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.