DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and foxe1

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:XP_005159967.1 Gene:foxe1 / 567676 ZFINID:ZDB-GENE-061116-1 Length:354 Species:Danio rerio


Alignment Length:340 Identity:108/340 - (31%)
Similarity:160/340 - (47%) Gaps:63/340 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARD 134
            ||||||||||:|||.|:.|:|:||.|||::|.||||:||||.:.|||||||||:||:||:|:.|:
Zfish    40 KPPYSYIALISMAIANSPDRKLTLGGIYKFITERFPFYRDNSKKWQNSIRHNLTLNDCFIKIPRE 104

  Fly   135 DKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVMREKEEA----------IKRQAMMNEKL 189
            ..:||||:||.|||::.:||::|||||||:|||:.|........          |.|.|..|...
Zfish   105 PGRPGKGNYWALDPNAEDMFESGSFLRRRKRFKRSDFTTYSSYVHESPVFSPVQIARSAYANSVY 169

  Fly   190 AEMKPLKLMTNGILEAKHM-------AAHAAHFKKEPLMDLGCLSGKEVSHAAML--NSCHDSLA 245
            :.|.........:..|.:.       |..:..|:...|:......|:   :|.|:  .||.....
Zfish   170 SNMAVSPPYAQQLPSAYYQSSSPNFTAGQSRVFRINSLIGSPSRMGQ---NAEMIPQQSCRSFSP 231

  Fly   246 QMN--HLAGGGVEHPGFTVDSLMNVYNPRIHHSAYPYHLNEDNLATVASSQMHHVHHAAAAHHAQ 308
            :..  .|.|.|.:|.....:::::.|:...::.|:.|                    :...|...
Zfish   232 ESGSCSLGGPGFQHQSCNGETVLSCYSSSSNNMAFAY--------------------SGPGHGQT 276

  Fly   309 QLQRHVAHVAHPLTPGGQGAGGQSSGHSPTTISTPHG---PAHGGWYTPETPPSEPVPHN----- 365
            |:....|...| ..|.|:.|....|..:...:..|:|   ||..|.:         |.:|     
Zfish   277 QVSYPQASTQH-YGPAGRMAISSLSPIAGDAVGDPYGRTSPAQLGSF---------VQYNNSGAV 331

  Fly   366 GQQGT-PTHPGHNNN 379
            |..|. ..||.::.|
Zfish   332 GSSGAYIRHPAYSGN 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 56/85 (66%)
foxe1XP_005159967.1 FH 40..128 CDD:214627 56/87 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.