DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and foxo6a

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:XP_690041.2 Gene:foxo6a / 561541 ZFINID:ZDB-GENE-110914-126 Length:594 Species:Danio rerio


Alignment Length:507 Identity:113/507 - (22%)
Similarity:174/507 - (34%) Gaps:172/507 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 SYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRD-----NKQGWQNSIRHNLSLNECFVKVAR 133
            ||..||..||::..||::||:.||.:::...||::|     :..||:|||||||||:..|::|  
Zfish    96 SYAELITRAIESTPDKRLTLSQIYDWMVRYVPYFKDKGDSNSSAGWKNSIRHNLSLHTRFIRV-- 158

  Fly   134 DDKKPGKGSYWTLDPDSYNMFDNGSFLRRR--------RRFKKKDVMREKEEAIKRQAMMNEKLA 190
            .::..||.|:|.|:|:...:   |...|||        :..|.|.....|:...||: ...|.|.
Zfish   159 QNEGTGKSSWWMLNPEGGKL---GKSQRRRAVSMDNGIKPLKSKGRTNRKKTTGKRE-QSTETLL 219

  Fly   191 EM--KP----------------LKLMTNGILEAKHMAAHAAHFKKEPLMDLGCLSGKEVSHAAML 237
            |.  .|                ..|.:.|......::.|.:     |::..|.|...|...    
Zfish   220 EFCSSPDSGTGRIVVKDEFDTWTDLHSLGSSSTSTLSGHLS-----PILGEGELGEPEERR---- 275

  Fly   238 NSCHDSLAQMNHLAGGGVEHPGFTVDSLMNVYNPRIHHSAYPYHLNEDNLATVASSQMHHVHHAA 302
            .||..|                           ||:..|....|....:..|...:.:.:..|.:
Zfish   276 KSCSAS---------------------------PRLFPSPSSAHSPASHCPTDLRATIGYKQHQS 313

  Fly   303 AAHHAQQLQRHVAHVAHPLTPGGQGAGGQSSGHSPTTISTPHGPAHG----GWYTPETPPSEPVP 363
            ..|.    ..|..:|:..          :|.|.|..|     .|.:|    |.:....|.:|  .
Zfish   314 PCHK----NPHYHYVSDI----------KSQGSSCET-----QPVYGLPDVGMHRSSIPTTE--D 357

  Fly   364 HNG-QQGTPT-----------------HPGHNNNNSSSVLNHNGVGNGGGGGGGGGGGSSSVLTS 410
            ::| .||..|                 |...|..:|..|                   |..:..|
Zfish   358 NSGSMQGASTIQNLLTTGPQQFVKEMMHGKENEVHSMMV-------------------SQGLHPS 403

  Fly   411 SP-TSALGFRDMIFEQNQSCQLD------TGSPT-GSLQS--------ASPPASASVAAASAAAA 459
            :| ||:..|.::|    ||...|      ...|| |.:||        .|||.:..:.|::|...
Zfish   404 NPNTSSKPFHNII----QSLSQDHRPTSVHSQPTDGHMQSYMHKSPYLYSPPVTVHLPASTALNP 464

  Fly   460 AAVISSHHHHHHHHAALSGNLGQLGQLSNLSHYRPHVGHY---QEYGIKYGV 508
            |.|              .|.......|:...:.:||...|   .|:.:.||:
Zfish   465 AGV--------------QGIAQDTCHLATTPYPQPHSYVYTDPHEHSLAYGL 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 34/86 (40%)
foxo6aXP_690041.2 FH 92..172 CDD:238016 32/77 (42%)
PAT1 <390..>530 CDD:330585 32/150 (21%)
FOXO-TAD 528..568 CDD:318811
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.