DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and si:rp71-45k5.2

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001038405.1 Gene:si:rp71-45k5.2 / 560783 ZFINID:ZDB-GENE-060503-753 Length:255 Species:Danio rerio


Alignment Length:222 Identity:61/222 - (27%)
Similarity:95/222 - (42%) Gaps:48/222 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 AYGLGAPHQN-KEIVKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERF-PYYRDNKQGWQNSI 118
            |...|||.:. |:....  :|..|||.|||.:.|||:|    ::.||.:. |:....|:..:|:|
Zfish    14 AQSSGAPRRRLKQCAAG--TYTGLIAYAIQESPDKKLT----FKEIMTKLEPFVFGEKRSIENNI 72

  Fly   119 RHNLSLNECFVKVARDDKKPG-KGSYWTLDPDSYNMFDNGSFLRR-RRRFK-----------KKD 170
            |..||.|:|||||..|...|. |.:||.:|       :||...:. ||.||           :.|
Zfish    73 RVCLSSNKCFVKVPVDPDYPNPKKNYWKVD-------ENGITPKMLRRHFKHIMHMFPGLMARGD 130

  Fly   171 VMREKEEAIKRQAMMNEKLAEMK---PLKLMTNGILEAKH---------MAAHAAHFKKEPLMDL 223
            ..|..::.:.......|..:|:|   |..:  ..:|::.|         |..| .|::     :.
Zfish   131 YSRVHDDTLVPVCKATENKSEVKFTGPFSI--ESLLKSDHGVKRMRSTQMEEH-PHYR-----EA 187

  Fly   224 GCLSGKEVSHAAMLNSCHDSLAQMNHL 250
            .|.:.|.....|.:...:...|:.|||
Zfish   188 QCAATKRKHMYAAVECFYPVSAEGNHL 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 32/87 (37%)
si:rp71-45k5.2NP_001038405.1 FH 31..102 CDD:294049 31/74 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.