DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and FOXJ2

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:XP_011519062.1 Gene:FOXJ2 / 55810 HGNCID:24818 Length:591 Species:Homo sapiens


Alignment Length:397 Identity:108/397 - (27%)
Similarity:164/397 - (41%) Gaps:117/397 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 APHQNKEIVKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLN 125
            |.||:.   ||.|||..||..||.::..||:||:.||::|.:.||||::...||:||||||||||
Human    60 AVHQDG---KPRYSYATLITYAINSSPAKKMTLSEIYRWICDNFPYYKNAGIGWKNSIRHNLSLN 121

  Fly   126 ECFVKVARDDKKPGKGSYWTLD--PDSYNMFDNGSFLRRRRRFKKKDVMRE---KEEAIKR---- 181
            :||.||.|....||||||||:|  ||          :.|:||....|.:.:   ::||.|.    
Human   122 KCFRKVPRPRDDPGKGSYWTIDTCPD----------ISRKRRHPPDDDLSQDSPEQEASKSPRGG 176

  Fly   182 -----QAMM----NEKLAEMKPLKLMT----NGILEAKHMAAHAAHFKKEPLMDLGCLSGKEVSH 233
                 :|.:    |.:::...|..:.:    .|.::...:||.|              ||:|.:.
Human   177 VAGSGEASLPPEGNPQMSLQSPTSIASYSQGTGSVDGGAVAAGA--------------SGRESAE 227

  Fly   234 A--AMLNSCHD---SLAQMNHLAGGGVEHPGFTVD---SLMNVYNPRIH-HSAYPYHLNEDNLAT 289
            .  .:.|:.||   |.:::|.            .|   |..|:|...:. .|:...|.....|..
Human   228 GPPPLYNTNHDFKFSYSEINF------------QDLSWSFRNLYKSMLEKSSSSSQHGFSSLLGD 280

  Fly   290 VASSQMHHVHHAAAAHHAQQLQRH------------------------VAHVAHPL--------- 321
            :..|..::::........||.|:.                        ....|.||         
Human   281 IPPSNNYYMYQQQQPPPPQQQQQQQQPPQPPPQQSQPQQQQAPAQGPSAVGGAPPLHTPSTDGCT 345

  Fly   322 TPGGQGAGGQSSGHSPTTISTPHGP--AHGGWYTPETPPSEPVPHN--GQQGTPTHPGHNNNNSS 382
            .|||:.||.:  |:.|..:...|.|  .|||::     |.:..||:  .||..|..|   .....
Human   346 PPGGKQAGAE--GYGPPPVMAMHPPPLQHGGYH-----PHQHHPHSHPAQQPPPPQP---QAQGQ 400

  Fly   383 SVLNHNG 389
            :.:|:.|
Human   401 APINNTG 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 48/87 (55%)
FOXJ2XP_011519062.1 Forkhead 66..143 CDD:278670 45/76 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.