DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and zgc:113424

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001038244.1 Gene:zgc:113424 / 554876 ZFINID:ZDB-GENE-050227-9 Length:300 Species:Danio rerio


Alignment Length:267 Identity:62/267 - (23%)
Similarity:112/267 - (41%) Gaps:63/267 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 ASAYGLGAPHQNKEIVKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERF-PYYRDNKQGWQNS 117
            :|:...|||.:.|:....  :|..|||.||:.:.|||:|    ::.||::. |:....|:.::|:
Zfish    50 SSSQSSGAPRRMKQCAAG--TYTGLIAYAIRESPDKKLT----FKQIMKKLEPFVFGEKRNFENN 108

  Fly   118 IRHNLSLNECFVKVARDDKKPG-KGSYWTLD-----PDSYN--------MFDNGSFLRRRRRFKK 168
            ||..||..:|||||..|...|. |.::|.:|     |..:.        ||.:.| ::.:...|.
Zfish   109 IRVCLSAKKCFVKVPVDPDYPNPKKNFWKVDESCITPKLFQRHFKYIMPMFPDNS-IQTQWVHKC 172

  Fly   169 KDVMREKEEAIKRQAMMNEKLAEMK---PLKLMTNGILEAKH---------MAAHAAHFKKEPLM 221
            :|.....|:.:. ...:.|..:|:|   |..:  ..:|::.|         |..| .|::     
Zfish   173 EDKPSAPEKLLP-VCKVTENKSEVKFTGPFSI--ESLLKSDHGVKRMRSTQMEEH-PHYR----- 228

  Fly   222 DLGCLSGKEVSHAAMLNSCHDSLAQMNHLAGGGVEHPGFTVDSLMNVYNPRIHHS-----AYPYH 281
            :..|.:.|.....|.:...:...|:.||               |::...||:...     ::|..
Zfish   229 EAQCAATKRKHMYAAVECFYPVSAEGNH---------------LVSTKRPRLSSGPQLGLSFPQQ 278

  Fly   282 LNEDNLA 288
            :..|:.|
Zfish   279 IKYDHRA 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 32/100 (32%)
zgc:113424NP_001038244.1 FH 69..142 CDD:294049 29/76 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.