DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and foxi4.1

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:XP_012818282.1 Gene:foxi4.1 / 549541 XenbaseID:XB-GENE-5996107 Length:381 Species:Xenopus tropicalis


Alignment Length:358 Identity:116/358 - (32%)
Similarity:165/358 - (46%) Gaps:81/358 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TLFSDQNSFTRHYAQTAAGYG---------------------SASAVAAASSASAAAAAHYAYDQ 46
            :::..||   .|.:|.|..||                     |.|.:...|.||....::.:..|
 Frog    39 SMYHQQN---LHSSQRAPNYGIGDYAPPTNPYLWLGGPGVSNSPSYLHGNSPASFMPPSYRSQRQ 100

  Fly    47 YSRYPYSASAYG-----LGAPHQNK--EIVKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERF 104
            :  ...|:|..|     |....|.:  ::|:|||||.||||||||||.:||:||:.||||:.:.|
 Frog   101 F--LSNSSSFCGTDLSWLSVASQEELLKVVRPPYSYSALIAMAIQNAPEKKLTLSQIYQYVADNF 163

  Fly   105 PYYRDNKQGWQNSIRHNLSLNECFVKVARDDKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKK 169
            |:|:.:|.|||||||||||||:||.||.||:..||||:||||||:...|||||:|.|:|:|  :.
 Frog   164 PFYKRSKAGWQNSIRHNLSLNDCFKKVPRDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRKR--RS 226

  Fly   170 DVMREKEEAIKRQ---AMMNEKLAEMKPLKLM-TNGILEAKHMAAHAAHFKKEPLMDLGCLSGKE 230
            |....:...:|.:   ..:..|..| .||.|. ::..|||      |:..:|.       .|...
 Frog   227 DSSSAEAVTVKGEEGRPALGGKGGE-SPLMLTPSSPELEA------ASDGRKS-------TSPSG 277

  Fly   231 VSHAAMLNSCHDSLAQM--------------NHLAGGGVEHPG-FTVDSLMNVYNPRIHHSAYPY 280
            ::.:..||:...|:..:              |.|:...:...| ||..|   |..|.:.......
 Frog   278 ITSSPCLNNFFSSMTSLDTTSVNRQMSMGLVNELSQRNITGLGSFTSGS---VAEPSVDLQDNSL 339

  Fly   281 HLNEDNLATVASSQMHHVHHAAAAHHAQQLQRH 313
            |||..:..:..||          .|...|...|
 Frog   340 HLNRPSYYSTLSS----------THQNNQFNSH 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 58/85 (68%)
foxi4.1XP_012818282.1 Forkhead 129..214 CDD:365978 57/84 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.