DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and foxi2

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001016544.1 Gene:foxi2 / 549298 XenbaseID:XB-GENE-982122 Length:350 Species:Xenopus tropicalis


Alignment Length:307 Identity:109/307 - (35%)
Similarity:149/307 - (48%) Gaps:85/307 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RHYAQTAAGYGSASAVAAASSASAAAAAHYAY--------DQY----SRYPYSASAYG------- 58
            |..|..|.|||       .:..|:..|:.|.:        ..|    |..||..:.||       
 Frog    22 RPAAPPALGYG-------RNEYSSPTASPYPWLNGPAMNSSPYLNGGSGSPYFPAGYGGGQRQFI 79

  Fly    59 -------------LGAPHQNK--EIVKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYR 108
                         |..|:|..  ::|:|||||.:||||||||..:||:||:.||.|:.|.||:|:
 Frog    80 PPSSGFGVADFPWLSIPNQADLLKMVRPPYSYSSLIAMAIQNNPEKKLTLSQIYSYVAENFPFYK 144

  Fly   109 DNKQGWQNSIRHNLSLNECFVKVARDDKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKK---- 169
            .:|.|||||||||||||:||.||||||..||||:||||||:...|||||:|.|:|:|..:.    
 Frog   145 KSKAGWQNSIRHNLSLNDCFKKVARDDNDPGKGNYWTLDPNCEKMFDNGNFRRKRKRKSESVEAG 209

  Fly   170 ---DVMREKEE-AIKRQAMMNEKLAEMKPLKLMTNGILEAKHMAAHAAHFKKEPLMDLGCLSGKE 230
               |...:|:| |:|  ::.::.......|:..:.|..|:|...|             |.|:..:
 Frog   210 FDGDASEDKKELALK--SLGSDSPRGASALEQSSYGTPESKSRPA-------------GGLAALD 259

  Fly   231 VSHAAMLNSCHDSLAQMNHLAGGGVEHPGFTVDSLMNVYNPRIHHSA 277
            .||      |..:.|.              .:::||||..|| |.||
 Frog   260 SSH------CFTNFAS--------------NMNALMNVGAPR-HFSA 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 58/85 (68%)
foxi2NP_001016544.1 Forkhead 106..192 CDD:278670 58/85 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.