DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and Foxo4

DIOPT Version :10

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_061259.1 Gene:Foxo4 / 54601 MGIID:1891915 Length:505 Species:Mus musculus


Alignment Length:243 Identity:69/243 - (28%)
Similarity:111/243 - (45%) Gaps:70/243 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 SYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRD-----NKQGWQNSIRHNLSLNECFVKVAR 133
            ||..||:.||::|.:|::||..||::::...||::|     :..||:|||||||||:..|:||  
Mouse   105 SYAELISQAIESAPEKRLTLAQIYEWMVRTVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIKV-- 167

  Fly   134 DDKKPGKGSYWTLDPD-----------SYNMFDNGSFLRRRRR--FKKKDVM------------- 172
            .::..||.|:|.|:||           :.:|..:...||.|.:  .||..|:             
Mouse   168 HNEATGKSSWWMLNPDGGKGGKAPRRRAASMDSSSKLLRGRSKGPKKKPSVLPAPPEGATPRSPL 232

  Fly   173 ------------REKEEA----------IKRQAMMNEKLAEMKPLKLMTNGILEAKHMAAHAAHF 215
                        |.:|||          ....:.::.:|:.|:|    .:.:|..:.|.|.|:.:
Mouse   233 GHFAKWSSSPCPRNREEADVWTTFRPRSSSNASTVSTRLSPMRP----ESEVLAEEEMPASASSY 293

  Fly   216 K--KEPLM--DLGCLSGKEVSHAAMLNSCHDSLAQMNHLAGGGVEHPG 259
            .  ..|.:  ||..|.|..      |.|.| ||...:.|:|..::|||
Mouse   294 AGGVPPTLSEDLELLDGLN------LASPH-SLLSRSGLSGFSLQHPG 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 FH_FOX 69..159 CDD:469596 37/100 (37%)
Foxo4NP_061259.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..66
Required for interaction with FOXK1. /evidence=ECO:0000269|PubMed:22956541 97..215 40/111 (36%)
FH_FOXO4 98..183 CDD:410836 34/79 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..244 12/68 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..276 2/18 (11%)
FOXO_KIX_bdg <359..399 CDD:465228
FOXO-TAD 466..503 CDD:435506
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.