DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and foxj1

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:XP_012827170.1 Gene:foxj1 / 496834 XenbaseID:XB-GENE-853648 Length:512 Species:Xenopus tropicalis


Alignment Length:321 Identity:90/321 - (28%)
Similarity:129/321 - (40%) Gaps:94/321 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SASAAAAAHYAYDQYSRYPYSASAYGLGAPHQNKEIVKPPYSYIALIAMAIQNAADKKVTLNGIY 97
            |:|.:.|:|..........|..:      ||     |||||||..||.||:|.:...|:||:.||
 Frog   171 SSSTSRASHLGLQPMEDIDYKTN------PH-----VKPPYSYATLICMAMQASKKTKITLSAIY 224

  Fly    98 QYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARDDKKPGKGSYWTLDPDSYNMFDNGSFLRR 162
            ::|.:.|.|:|.....||||||||||||:||:||.|:..:||||.:|.:||...:...||:..:|
 Frog   225 KWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWKIDPQYADRLMNGAMKKR 289

  Fly   163 RR------------------------------RFKKKDVMREKEEAIKRQAMMNEKLAEMKPLKL 197
            |.                              ..:...:::|.|||...|..  ..|.|..    
 Frog   290 RLPPVQIHPAFASAQAAASGNSNRGSPWQLSVNSESHQLLKEFEEATGEQGW--NALGEHG---- 348

  Fly   198 MTNGILEAKHMAAHAAHFKKEPLMDLGCLSGKEVSHAAMLNS----CHDSLAQMNHLAG------ 252
             .|.|.:.|      :|.:|:||       .|.:..|..|:|    |.:...::..|.|      
 Frog   349 -WNAISDGK------SHKRKQPL-------PKRMFKAPRLSSSPMLCQEEQTELGSLKGDFDWEV 399

  Fly   253 ------GGVEHPGF--------------TVDSLMNVYNPRIHHSAYPYHLNEDNLATVASS 293
                  .||....|              :||  :.|:...|......|.|.:|. |.|.:|
 Frog   400 IFDSSMNGVNFSAFEDLEVTPPLSPVTRSVD--LTVHGKHIDCPQQWYPLGQDQ-AVVQNS 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 44/85 (52%)
foxj1XP_012827170.1 Forkhead 197..283 CDD:278670 44/85 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.