DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and foxj1b

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001008648.1 Gene:foxj1b / 494105 ZFINID:ZDB-GENE-041212-76 Length:442 Species:Danio rerio


Alignment Length:400 Identity:114/400 - (28%)
Similarity:155/400 - (38%) Gaps:111/400 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 HYAQTAAGYGSASAVAAASSAS--------------AAAAAHYAYDQYSRYPYSASAYGLGAPHQ 64
            :|.....|..|.|:..|..:|:              ::.|..||..|       |..|..|..:.
Zfish    69 YYKNQLGGTDSPSSPPAGDTAATGMPQTPGNPTTSCSSLANPYALQQ-------AGQYITGQTNP 126

  Fly    65 NKEI-------VKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNL 122
            .:||       |||||||..||.||:|.:...|:||:.||.:|.|.|.|||..:..|||||||||
Zfish   127 AEEIDYKTNRHVKPPYSYATLICMAMQASNKTKITLSAIYSWITENFCYYRYAEPSWQNSIRHNL 191

  Fly   123 SLNECFVKVARDDKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVMRE------------- 174
            |||:||:||.|...:||||.:|.:||...:||.||.|.|||......:..|:             
Zfish   192 SLNKCFMKVPRQKDEPGKGGFWQIDPQYADMFVNGVFKRRRMPATNFNTQRQSKMLSSPSSSYTS 256

  Fly   175 ----------------KEEAIKRQAMMNEKLAEMKPLKLMTNGILEAKHMAAHAAHFKKEPLMDL 223
                            |::..||    ..|||.:....|:|:.|   |........|....:.| 
Zfish   257 QCNQQMGMGHFQGNKRKQDFPKR----GNKLARISKSPLLTSDI---KTSDVLRGDFDLASVFD- 313

  Fly   224 GCLSGKEVSHAAM-LNSCHDSLAQMNHLAGGGVEHPGFTVDSLMNVYNPRIHHSAYPYHLNEDNL 287
            ..|||.:.:...: :|:...||              |..::....::|    .|.|.   |||..
Zfish   314 DVLSGNDSTFEDLDINTALSSL--------------GCEMEPSSQIHN----QSGYS---NEDEQ 357

  Fly   288 AT-------VASSQMHHVHHAAAAHHAQQLQRHVAHVAHPLTPGGQGAGGQSSGH--------SP 337
            |.       :....|...||   ..|.||.|      .||....|..:..|:..|        .|
Zfish   358 ACAYLEANGIIGCNMEDFHH---QQHHQQAQ------VHPQYYEGMFSDQQNQQHPWEIKEEAQP 413

  Fly   338 TTISTPHGPA 347
            ..:|..||.|
Zfish   414 VPLSLDHGYA 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 48/85 (56%)
foxj1bNP_001008648.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..106 5/32 (16%)
Forkhead 139..225 CDD:278670 48/85 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.