DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and foxd1

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001008148.1 Gene:foxd1 / 493510 XenbaseID:XB-GENE-488077 Length:329 Species:Xenopus tropicalis


Alignment Length:128 Identity:74/128 - (57%)
Similarity:93/128 - (72%) Gaps:8/128 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PYSASAYGLGAPHQNKEIVKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQ 115
            ||..:..|.|    ...:|||||||||||.|||..:..|::||:.|.::|..||||||:....||
 Frog    53 PYKGTGGGGG----RSALVKPPYSYIALITMAILQSPKKRLTLSEICEFISNRFPYYREKFPAWQ 113

  Fly   116 NSIRHNLSLNECFVKVARDDKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKD----VMRE 174
            ||||||||||:||||:.|:...||||:||||||:|.:|||||||||||:|||::.    |:||
 Frog   114 NSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGSFLRRRKRFKRQQAPELVLRE 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 54/85 (64%)
foxd1NP_001008148.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..63 4/13 (31%)
Forkhead 68..153 CDD:365978 53/84 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.