DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and fd102C

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster


Alignment Length:372 Identity:95/372 - (25%)
Similarity:137/372 - (36%) Gaps:99/372 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GYGSASAVAAASSASAAAAAHYAYDQYSRYPYSASAYGLGAPHQNKEIVKPPYSYIALIAMAIQN 85
            |.||..:|...::.|.          .|.:|.:...:       ..|..||.:|||.||||||.:
  Fly    97 GSGSLPSVNRMAALST----------ISLFPQTQRIF-------QPEEPKPQHSYIGLIAMAILS 144

  Fly    86 AADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARDDKKPGKGSYWTLDPDS 150
            :.|.|:.|:.|||||::.:||:|....||:||||||||||:||:|..|...  |||.||.:.|.:
  Fly   145 STDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRSAN--GKGHYWAIHPAN 207

  Fly   151 YNMFDNGSFLRRRRRFKKKDVMREKEEAIKRQAMMNEKLAEMKPLKLMTNGILEAKHMAAH---- 211
            ...|..|.|.||:.:.|.:                                    |||...    
  Fly   208 MEDFRKGDFRRRKAQRKVR------------------------------------KHMGLSVDDA 236

  Fly   212 AAHFKKEPLMDLGCLSGKEVSHAAMLNSCHDSLAQ------MNHLAGGGVEH-----PGF----- 260
            :......|.:||..........|..|::......|      .|..:..|:.|     |..     
  Fly   237 STDSPSPPPLDLTTPPPPSSQSALQLSALGYPYHQHYIGQFFNRSSAPGMTHYSPPDPALLMQRQ 301

  Fly   261 ---TVDSLM---NVYNPRIHHSAYPYHLNEDNLATVASSQMHHVHHAAAAHHAQQLQRHVAHVAH 319
               .:|..:   .:..|..||..:.| :|.....|:|:.             ..|.::....||.
  Fly   302 EANNLDQTIQPTQLQQPHSHHQHFAY-INSTTTTTIANM-------------FSQTRKRQFDVAS 352

  Fly   320 PLTPGGQ----GAGGQSSGHSPTTISTPHGPAHGGWYTPETPPSEPV 362
            .|.|..|    .:..|.|..:|||.:......|....|.:|...|.|
  Fly   353 LLAPDVQIVDIVSEDQESSVTPTTSARTTTQTHHTVITKQTIHREVV 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 45/85 (53%)
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 45/85 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445540
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46670
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.