DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and foxo

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001262557.1 Gene:foxo / 41709 FlyBaseID:FBgn0038197 Length:622 Species:Drosophila melanogaster


Alignment Length:468 Identity:113/468 - (24%)
Similarity:177/468 - (37%) Gaps:156/468 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SASAVAAASSASAAAAAHYAYDQYSRYPYSASAYGLGAPHQNKEIVKPPYSYIALIAMAIQNAAD 88
            |...:|...|..|...|:.|....||    .:|:|             ..||..||..||.:|.|
  Fly    66 SNQQLAPGDSQQAIQNANAAKKNSSR----RNAWG-------------NLSYADLITHAIGSATD 113

  Fly    89 KKVTLNGIYQYIMERFPYYRD-----NKQGWQNSIRHNLSLNECFVKVARDDKKPGKGSYWTLDP 148
            |::||:.||:::::..||::|     :..||:|||||||||:..|::|  .::..||.|:|.|:|
  Fly   114 KRLTLSQIYEWMVQNVPYFKDKGDSNSSAGWKNSIRHNLSLHNRFMRV--QNEGTGKSSWWMLNP 176

  Fly   149 DSYNMFDNGSFLRRR-------RRFKKKDVMREKEEAIKRQAMMNEKLAEMKPLKLMTNGILEAK 206
            ::    ..|..:|||       |..|::...:::.||:::..::....|...|...::.|:    
  Fly   177 EA----KPGKSVRRRAASMETSRYEKRRGRAKKRVEALRQAGVVGLNDATPSPSSSVSEGL---- 233

  Fly   207 HMAAHAAHFKKEPLMDLGCLSGKEVS----HAAMLNSCHDSLAQMNHLAGGGVEHP-GFTVDSLM 266
                  .||.:.||...|   |.::|    ..|..|:  .|..:::.:....:|.. ||.||   
  Fly   234 ------DHFPESPLHSGG---GFQLSPDFRQRASSNA--SSCGRLSPIRAQDLEPDWGFPVD--- 284

  Fly   267 NVYNPRIHHSAYPYHLNEDNLATVASSQMHHVHHAAAAHHAQQLQRHVAHVAHPLT------PGG 325
                            .::...|.|              |||.|:.....:|..||      .|.
  Fly   285 ----------------YQNTTMTQA--------------HAQALEELTGTMADELTLCNQQQQGF 319

  Fly   326 QGAGGQSSGHSPTTISTP-----------------HGPAHGGWYTPETPPSE---------PVPH 364
            ..|.|..|...|.....|                 :|||.|  |....|.|:         ...|
  Fly   320 SAASGLPSQPPPPPYQPPQHQQAQQQQQQQSPYALNGPASG--YNTLQPQSQCLLHRSLNCSCMH 382

  Fly   365 NGQQG----------TPTHPGHNNNNSSSVLNHNGVGNGGGGGGGGGGGSSSVLTSSP--TSALG 417
            |.:.|          :|.:|  |:..||..||                ..|:|:...|  |:|| 
  Fly   383 NARDGLSPNSVTTTMSPAYP--NSEPSSDSLN----------------TYSNVVLDGPADTAAL- 428

  Fly   418 FRDMIFEQNQSCQ 430
               |:.:|.|..|
  Fly   429 ---MVQQQQQQQQ 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 35/90 (39%)
foxoNP_001262557.1 FH 95..175 CDD:238016 34/94 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445550
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.