DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and jumu

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster


Alignment Length:201 Identity:59/201 - (29%)
Similarity:100/201 - (49%) Gaps:17/201 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TLFSDQNSFTRHYAQTAAGYGSASAVAAASSASAAAAAHYAYDQYSRYPYSASAYGLGAPHQNK- 66
            ::.|..|| ..|..|:....||.|:::::|::|.........: .:....|.:..||..|.|.| 
  Fly   338 SIASAANS-PHHQMQSNYSLGSPSSLSSSSASSPLGNVSNLVN-IANNNTSGAGSGLVKPLQQKV 400

  Fly    67 -------EIVKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSL 124
                   ...||.|||..|||:|::|:....:.::.||.::.:.|||:.:...||:||:||||||
  Fly   401 KLPPVGSPFPKPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNSVRHNLSL 465

  Fly   125 NECFVKVAR--DDKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVMREKEEAIKRQAMMNE 187
            |:||.|:.|  .:....||..|.::||..|..|     ...:::.:||....:...:..|.:.:.
  Fly   466 NKCFEKIERPATNGNQRKGCRWAMNPDRINKMD-----EEVQKWSRKDPAAIRGAMVYPQHLESL 525

  Fly   188 KLAEMK 193
            :..|||
  Fly   526 ERGEMK 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 36/87 (41%)
jumuNP_524302.1 Forkhead 411..499 CDD:278670 37/92 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445535
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.