DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and foxf2a

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001077284.1 Gene:foxf2a / 407681 ZFINID:ZDB-GENE-110407-5 Length:383 Species:Danio rerio


Alignment Length:462 Identity:133/462 - (28%)
Similarity:184/462 - (39%) Gaps:129/462 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SASAAAAAHYAYDQYSRYPYSASAYGLGAPHQN---KEIVKPPYSYIALIAMAIQNAADKKVTLN 94
            |:.|:.:.|.|.........|.:|.|......|   :...||||||||.|.||||::..|::||:
Zfish    18 SSPASNSMHSALQNTQTVLESTTATGNKGKKSNSGMRRPEKPPYSYIAPIVMAIQSSPTKRLTLS 82

  Fly    95 GIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARDDKKPGKGSYWTLDPDSYNMFDNGSF 159
            .|||::..|||::|.:.|||:||:||||||||||:|:.:...:||||.|||:||.|..||:.|||
Zfish    83 EIYQFLQARFPFFRGSYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPGSEFMFEEGSF 147

  Fly   160 LRRRRRFKKKDVMREKEEAIKRQAMMNEKLAEMKPLKLMTNGILEAKHMAAHAAHFKKEPLMDLG 224
            .||.|.|::                   |...:||:..|.|||.....|......| :.|...|.
Zfish   148 RRRPRGFRR-------------------KCQALKPMYRMMNGIGFGASMLPQNFDF-QSPSASLA 192

  Fly   225 CLSGKEVSHAAMLNSCHDSLAQMNHLAGGGVEHPGFTVDSLMNVYNPRIHHSAYPYHLNEDNLAT 289
            |       ||   ||                    :.:|.:.|        :....|...|.|..
Zfish   193 C-------HA---NS--------------------YNLDMMSN--------AVQGVHAGYDGLGA 219

  Fly   290 VASSQMHHVHHAAAAHHAQQLQRHVAHVAHPLTPGGQGAGGQSSG-HSPTTIS------TPHG-- 345
                 .|||.|.:.:..:..:.  ...||   :.|..|....:|. |||.|:|      :|:|  
Zfish   220 -----GHHVSHMSPSTGSTYMT--ACQVA---SNGEYGPDSSNSPLHSPPTMSGSLECHSPYGAA 274

  Fly   346 PAHGGWYTPETPPSEPVPHNGQQ----GTPTHPG-HNN----NNSSSVLNHNGVGNGGGGGGGGG 401
            .|||.       .|...|:..||    .:||..| |::    :...|.|:|||..:....|....
Zfish   275 SAHGA-------SSGVSPYIKQQPLSSSSPTSSGLHSSMPPYSLEQSYLHHNGRDSADISGMSRY 332

  Fly   402 GGSSSVLTSSPTSALGFRDMIFEQNQSCQLDTGSPTGSLQSASPPASASVAAASAAAAAAVISSH 466
            ...||.:.......|.|                   ..:.|..|..|.|.              :
Zfish   333 QSHSSPVCDRKDFVLNF-------------------NGITSFHPSTSGSY--------------Y 364

  Fly   467 HHHHHHH 473
            ||..|||
Zfish   365 HHQLHHH 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 51/85 (60%)
foxf2aNP_001077284.1 FH 58..146 CDD:214627 51/87 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.