DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and foxg1b

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_998079.2 Gene:foxg1b / 405850 ZFINID:ZDB-GENE-040426-2437 Length:341 Species:Danio rerio


Alignment Length:373 Identity:111/373 - (29%)
Similarity:152/373 - (40%) Gaps:140/373 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 QNKEIVKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECF 128
            :.|:..|||:||.|||.|||:.:.:|::||||||::||:.|||||::|||||||||||||||:||
Zfish    71 KGKKFDKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYREHKQGWQNSIRHNLSLNKCF 135

  Fly   129 VKVARDDKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVMREKEEAIKRQAMMNEKLAEMK 193
            |||.|....||||:||.|||.|.::|..|:..:.|||           .|..|..::.::.....
Zfish   136 VKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRR-----------SATSRGKLVMKRGLRFA 189

  Fly   194 PLKLMTNGILEAKHMAAHAAHFKKEPLMDLGCLSGKEVSHAAMLNSCHDSLAQMNHLAGGGVEHP 258
            ||.|                        .||                               |.|
Zfish   190 PLGL------------------------GLG-------------------------------ERP 199

  Fly   259 GFTVDSLMNVYNPRIHHSAYPYHLNEDNLATVASSQMHHVHHAAAAHHAQQLQRHVAHVAHPLTP 323
            .          || ::....|:            ..:||.|:..:||..    .:..|....|.|
Zfish   200 S----------NP-LYWQLSPF------------LPLHHSHYNGSAHGF----LNQGHTYGTLLP 237

  Fly   324 GGQGAG---------GQSSGHSPTTISTPHG---PA------HGGWYTPETPPSEPVPHNGQQGT 370
            |.:..|         |.|||  ...:|..:|   ||      |.|::.|..  .:|      |..
Zfish   238 GVEPLGNGDMSRQILGASSG--SINLSNGYGVSPPAAGLLSGHNGYFVPGA--QQP------QSL 292

  Fly   371 PTHPGHNNNNSSSVLNHNGVGNGGGGGGGGGGGSSSVLTSSP--TSAL 416
            |:.||:..::|.|.|.                 |.|:.||.|  ||.|
Zfish   293 PSAPGYGISSSQSPLL-----------------SDSLRTSLPSFTSPL 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 57/85 (67%)
foxg1bNP_998079.2 FH 77..165 CDD:214627 57/87 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.