DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and foxi1

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_988949.1 Gene:foxi1 / 394546 XenbaseID:XB-GENE-494125 Length:373 Species:Xenopus tropicalis


Alignment Length:397 Identity:126/397 - (31%)
Similarity:175/397 - (44%) Gaps:91/397 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 NSFTRHYAQTAAGY--GSASAVAAASSASAAAAAHYAYDQYS-RYPYSASAYGLGA--------P 62
            |..|..|:.||..|  .:..::........:..:|:....|. :.....:.:|||.        |
 Frog    49 NFETADYSTTANPYLWLNGPSITPPPYLPGSNTSHFMPQSYGMQRQLLPNMHGLGGSDLGWLPIP 113

  Fly    63 HQNK--EIVKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLN 125
            .|.:  ::|:|||||.|||||||..|.||::||:.||||:.:.||:|..:|.|||||||||||||
 Frog   114 SQEELMKLVRPPYSYSALIAMAIHGAPDKRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLN 178

  Fly   126 ECFVKVARDDKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVMREKEEAIKRQAMMNEKLA 190
            :||.||.||:..||||:||||||:...|||||:|.|:|:|  |.||            ..|.:::
 Frog   179 DCFKKVPRDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRKR--KSDV------------SPNGQIS 229

  Fly   191 EMKPLKLMTNGILEAKHMAAHAAHFKKEPLMDLGCLSGKEVSHAAMLNSCHDSLAQMNHLAGGGV 255
            ..||                     :..||.:    |.|...|       ||.|         |.
 Frog   230 SDKP---------------------EGSPLNE----SPKNGEH-------HDML---------GN 253

  Fly   256 EHPGFTVDSLMNVYNPRIHHSAYPYHLNEDNLATVASSQMHHVHHAAAAHHAQQLQRHVAHVAHP 320
            ..|| |.||......|   .|..|.      |....||...:|:.|.....:..|    .....|
 Frog   254 SSPG-TDDSSEKRSPP---PSITPC------LNNFLSSMTAYVNSANPVSRSVPL----GLTNEP 304

  Fly   321 LTPGGQGAGGQSSGHSPTTISTPHGPAHGGWYTPETPPSEPVPHNG---QQGTPTHPGHNNNNSS 382
            ....||...|.:| ::|.:    :.|:|||.....|..|.|..::.   .|.|| |..:..|.::
 Frog   305 SDRMGQNMVGLNS-YTPLS----NMPSHGGSDWSSTISSSPFGYSSSVFNQFTP-HFYNTINANN 363

  Fly   383 SVLNHNG 389
            ::.|..|
 Frog   364 TLYNREG 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 56/85 (66%)
foxi1NP_988949.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
Forkhead 123..208 CDD:365978 55/84 (65%)
COG5025 124..>308 CDD:227358 93/252 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 208..274 29/124 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.