DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and foxa4

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_988938.1 Gene:foxa4 / 394535 XenbaseID:XB-GENE-486455 Length:399 Species:Xenopus tropicalis


Alignment Length:277 Identity:103/277 - (37%)
Similarity:136/277 - (49%) Gaps:58/277 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PYSASAYGLG-------------APHQNKEIVKPPYSYIALIAMAIQNAADKKVTLNGIYQYIME 102
            |.|..||.:|             ...:|....|||||||:||.||||.|.:|.:|||.|||:|::
 Frog    87 PASTPAYPMGYCQGESEFQRDPRTYRRNYSHAKPPYSYISLITMAIQQAPNKMMTLNEIYQWIID 151

  Fly   103 RFPYYRDNKQGWQNSIRHNLSLNECFVKVARDDKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFK 167
            .|||||.|:|.|||||||:||.|:|||||.|..:||||||||||.|:|.|||:||.:|||::|||
 Frog   152 LFPYYRQNQQRWQNSIRHSLSFNDCFVKVPRSPEKPGKGSYWTLHPESGNMFENGCYLRRQKRFK 216

  Fly   168 KKDVMREKEEAIKRQAMMNEKLAEMKPLKLMTNGILEAKHMAAHAAHFKKEPLMDLGCLSGKEVS 232
                 .|:.::.:|:..:|:...|        ||           ...|:.|:....|.|.:. .
 Frog   217 -----CERSKSGEREKKVNKPGDE--------NG-----------GSLKETPVGYDDCSSSRS-P 256

  Fly   233 HAAMLNSCHDSLAQMNHLAGGG--------VEHPGFTVDSLMNVYNPRIHHSAYPYHLNEDNLAT 289
            .|.:.:...||.....|.|.||        .|..| |...||           ||..|:.|....
 Frog   257 QAPVNDGGRDSTGSSIHQASGGSPVGLSPTSEQAG-TASQLM-----------YPLGLSNDGYLG 309

  Fly   290 VASSQMHHVHHAAAAHH 306
            :....:|..|...:..|
 Frog   310 LVGEDVHLKHDPFSGRH 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 60/85 (71%)
foxa4NP_988938.1 Forkhead_N <25..118 CDD:369872 6/30 (20%)
COG5025 <118..303 CDD:227358 92/221 (42%)
FH 119..207 CDD:214627 61/87 (70%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..290 17/90 (19%)
HNF_C 326..387 CDD:370449 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.