DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and foxl1

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_957278.1 Gene:foxl1 / 393959 ZFINID:ZDB-GENE-040426-1181 Length:363 Species:Danio rerio


Alignment Length:178 Identity:88/178 - (49%)
Similarity:117/178 - (65%) Gaps:15/178 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SAVAAASSASAAAAAHYAY--DQYSRYPYSASAYGLGAPHQNKEIVKPPYSYIALIAMAIQNAAD 88
            |.|||::...:.::..|.|  :.....|....|.|...|.|     ||||||||||||||:||.|
Zfish    11 SGVAASALGLSGSSLIYVYGGEVGGIIPALGFASGRQEPPQ-----KPPYSYIALIAMAIKNAPD 70

  Fly    89 KKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARDDKKPGKGSYWTLDPDSYNM 153
            |:.||:||||:||:|||||.|||||||||||||||||:||:||.|:..:||||||||||....:|
Zfish    71 KRATLSGIYQFIMDRFPYYHDNKQGWQNSIRHNLSLNDCFIKVPREKGRPGKGSYWTLDTKCLDM 135

  Fly   154 FDNGSFLRRRRRFKKKDV-------MREKEEAIK-RQAMMNEKLAEMK 193
            |:||::.||:|:.:.:|.       .|.:..:.| .|...:||::.:|
Zfish   136 FENGNYRRRKRKCRTQDTGDTKVGHKRTRVTSFKLHQGAQSEKVSPLK 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 65/85 (76%)
foxl1NP_957278.1 FH 52..140 CDD:214627 66/87 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.