DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and FoxK

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster


Alignment Length:471 Identity:111/471 - (23%)
Similarity:172/471 - (36%) Gaps:167/471 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VAAASSASAAAAAHYAYDQYSRYPYSASAYGLG-----------APHQNKEIVKPPYSYIALIAM 81
            ::||:|..|:....:..:|.:.|    :.||..           |.:.:.|  ||||||..||..
  Fly   406 ISAANSCPASPRQGFIQNQPNNY----NNYGNNNTQDLFQTPSTASYNHNE--KPPYSYAQLIVQ 464

  Fly    82 AIQNAADKKVTLNGIYQYIMERFPYYR-DNKQGWQNSIRHNLSLNECFVKVARDDKKPGKGSYWT 145
            ||..|.||::||:|||.:|::.:|||| :..:|||||||||||||..|:||||...:|||||:|.
  Fly   465 AISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVARSQDEPGKGSFWR 529

  Fly   146 LDPDSYNMFDNGSFLRRRRRFKKKDVMREKEEAIKRQAMMNEKLAEMKPLKLMTNGILEAKHMAA 210
            :||||.....:.|:.:||:|..:                     ....|..:..:..:...||..
  Fly   530 IDPDSGAKLIDHSYKKRRQRSSQ---------------------GFRPPYGMPRSAPVSPSHMDN 573

  Fly   211 HAAHFKKEPLMDLGCLSGKEVSHAAMLNSCHDSLAQMNHLAGGGVEHPGFTVDSLMNVYNPRIHH 275
            ..   :..||.|:            :|.|...|              ||.:::  ....:|.|  
  Fly   574 SR---ESSPLQDI------------VLQSAPGS--------------PGMSLE--QRAADPEI-- 605

  Fly   276 SAYPYHLNEDNLATVASSQMHHVHHAAAAHHAQQLQRHVAHVAHPLTPGGQGAGGQSSGHSPTTI 340
                                  ::::..||..||.|:                            
  Fly   606 ----------------------IYNSQNAHQQQQQQQ---------------------------- 620

  Fly   341 STPHGPAHGGWYTPETPPSEPVPHNGQQGTPTHPGHNNNNSSSVLN-----HNGVGNGGGGGGG- 399
                          :....:.:.:|..|.:...|.:..|.||.|..     .....:||||||| 
  Fly   621 --------------QQQQQQTLSNNSNQYSSGSPYYVTNQSSGVATPQTHVEGSAASGGGGGGGV 671

  Fly   400 ------------GGGGSSSVLTSSPTSA-LGFRDMIFEQNQSCQLDTGSPT---GSLQSASPPAS 448
                        |||.|...|......| ....::|:|:         .||   |.::::.....
  Fly   672 GALLALKRNHVMGGGASQHTLHQQQAVAQQQHSEIIYEE---------LPTDYSGHIEASEEECV 727

  Fly   449 ASVAAASAAAAAAVIS 464
            .:...|:.|.....:|
  Fly   728 TTATDATVAKRPKYVS 743

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 51/86 (59%)
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 51/86 (59%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445548
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.